SecReT6
Protein ID: 15130917
SecReT6 ID896
T6SS typei3
Gene symbolsciB
Locus tagsciB
StrainSalmonella enterica subsp. enterica serovar Typhimurium SR11
Repliconchromosome [GenBank: AJ320483] [Browse all T6SS(s) in this replicon]
Location [Strand]1388..2263 [-]
ProductSciB protein
NoteTssG
UniProt IDQ93IT4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.50E-88, Aligned region: 2..270
Protein Sequence: 291 a.a.     [Download]
>gi|15130917|ref|CAC48199.1| SciB protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MEKFRLGQTPTMTFAPREIAQVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSN
IFHHRWLTQFWQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRN
PDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQSSVLGNGALIGQAVPDMQYKFRLIIGPLT
LEDYLRFLPGGNNLPVLTELVRTFIGFEYCWEIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTG
MIFEPEHGLTH
 
Nucleotide Sequence: 876 bp     [Download]
>gi|15130915|gb|AJ320483|sciB|:1388-2263
ATGGAAAAATTCCGTCTGGGACAGACGCCGACGATGACCTTTGCGCCACGGGAAATCGCCCAGGTCAGCT
GGCAGGATGGACGCCTGCACCTGAGCCTGTACAGCCTCGGACTATGGGGGCCAAACGGCCCGTTGCCGCT
GCACTATACCGAGCTGGCACTGAACCGCTCAGAGAGTCGTCACGATCCGACGCTGGTTCATTTTTCCAAT
ATTTTTCACCACCGCTGGCTGACGCAGTTCTGGCAGGCATGGCGCAGCGCCCAGTCCGCTGGTGGCGGGC
TGGACAAACCGGAACACGACCGTTTTGCGTTTTATATCGCCAGTCTCAGCGGGCAGGATCTACGGGAAAG
CGCCGAAAGCCCGCTGTCAGATCATGTTCGCCTGGCAGCCTCCGCCCATCTGGTACGCGAATCGCGCAAT
CCTGACGGGCTGGCCGCCACGCTGGCGCACTATTTCAGCGTACCTTTTGCGGTGAAAGAATTCGCCCTGC
ACTGGATAACGGTGGCGAACGATGAAATCACCCGTCTGGGCACGCCCGCGCAGTCTTCGGTGCTGGGCAA
CGGGGCGCTTATCGGCCAGGCCGTACCGGATATGCAGTACAAATTCCGGCTAATTATCGGCCCGCTCACG
CTGGAGGATTACCTGCGTTTTCTGCCCGGCGGCAACAATCTGCCCGTGCTGACAGAACTGGTGCGTACGT
TCATCGGTTTTGAATATTGCTGGGAAATTGAGCTGCAGTTGAAGCCTCATGCCGCACCGCCTGCGGTGAT
CGGCGGCGCGCAGCGGCTTGGCTGGACGGCCTGGGCAGGTAAAGCCATGCATGACCGTCCGGTGACCGGC
ATGATTTTTGAACCTGAACACGGCTTAACCCACTGA
 Primer design