SecReT6
Protein ID: 15130919
SecReT6 ID896
T6SS typei3
Gene symbolsciD
Locus tagsciD
StrainSalmonella enterica subsp. enterica serovar Typhimurium SR11
Repliconchromosome [GenBank: AJ320483] [Browse all T6SS(s) in this replicon]
Location [Strand]4281..4775 [-]
ProductSciD protein
NoteTssE
UniProt IDH9L4H3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|15130919|ref|CAC48201.1| SciD protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDKTRQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|15130915|gb|AJ320483|sciD|:4281-4775
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCCACGCTGTTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGCCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGCCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCATAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATAAAACCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA
 Primer design