SecReT6
Protein ID: 15130920
SecReT6 ID896
T6SS typei3
Gene symbolsciE
Locus tagsciE
StrainSalmonella enterica subsp. enterica serovar Typhimurium SR11
Repliconchromosome [GenBank: AJ320483] [Browse all T6SS(s) in this replicon]
Location [Strand]4772..5611 [-]
ProductSciE protein
NoteTagJ
UniProt IDQ93IT1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.50E-46, Aligned region: 148..271
Protein Sequence: 279 a.a.     [Download]
>gi|15130920|ref|CAC48202.1| SciE protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MEIPPMKKTDTLPATLSALIQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCA
RMEANYTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAI
TDTGGQWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDT
HGAWLFTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 840 bp     [Download]
>gi|15130915|gb|AJ320483|sciE|:4772-5611
ATGGAAATACCGCCCATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGATACAGGAATACT
CTATTGCGGAGGGGATTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAAGCGCTCTGCCGCCA
CAGCCTGTTTCAGTTGCTGTGTGTGGCCGGAGACTGGTCGCGGGCGCTACACCAGCTTCAGCTATGCGCC
AGGATGGAGGCCAATTATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCC
ACACCGTTTTTCAGGGTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCT
GGCGGCACTCGCCTGTCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATA
ACAGACACGGGCGGGCAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCC
CGGTACTTGAGCTAGTCACCGGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATC
GCCGCAACCGACGCGCCTGACTGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACG
CACGGCGCCTGGCTCTTTACCCGTTACAGCGGTTCGGAAAGTGCATCCGACGCCCTGCGTCTGTGCAGGG
AAACCGCCTGGCAGGACGGCCCCGGCGAAACCACCGTGCGGGCGCTGGGGCAGAAAGTGTGGCTGACCAG
CCACGGCGATATCAGCCTGCTGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA
 Primer design