SecReT6
Protein ID: 15130923
SecReT6 ID896
T6SS typei3
Gene symbolsciH
Locus tagsciH
StrainSalmonella enterica subsp. enterica serovar Typhimurium SR11
Repliconchromosome [GenBank: AJ320483] [Browse all T6SS(s) in this replicon]
Location [Strand]9592..10134 [+]
ProductSciH protein
NoteTssB
UniProt IDH9L4I8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-60, Aligned region: 11..164
Protein Sequence: 180 a.a.     [Download]
>gi|15130923|ref|CAC48205.1| SciH protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKSAATQQDVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|15130915|gb|AJ320483|sciH|:9592-10134
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGTTCCGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACTCAACTGGCGAACCTCCAGACCTACATGGATGGCAAGGCG
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACTCTGCTGAAAACGCTGGCGAATGCGCCGA
AATCGGCCGCTACCCAGCAAGATGTGTCAGCGGATAATGAATCAGCGGAATAA
 Primer design