SecReT6
Protein ID: 15130929
SecReT6 ID896
T6SS typei3
Gene symbolsciN
Locus tagsciN
StrainSalmonella enterica subsp. enterica serovar Typhimurium SR11
Repliconchromosome [GenBank: AJ320483] [Browse all T6SS(s) in this replicon]
Location [Strand]14920..15411 [+]
ProductSciN protein
NoteTssJ
UniProt IDQ93IS2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-41, Aligned region: 5..155
Protein Sequence: 163 a.a.     [Download]
>gi|15130929|ref|CAC48211.1| SciN protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDN
DKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIS
GKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|15130915|gb|AJ320483|sciN|:14920-15411
ATGCCTTTTGCACTGCTCCTGCTTTCCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGC
GACTCGACCTGAGCGTGAAAGCCTCCGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGA
GATACGTGTTTATGAACTGAAAAATGACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAAC
GACAAATCCGTCCTTACCGACGATTTAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAA
AACTGCGTCGCCCGCTGAATGCGCAGACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAA
ATCGGTCTGGCGGGTAACCTACAAAATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATATCG
GGGAAAGGAAAAGTGCAGTTGGAGGCGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAAT
GA
 Primer design