SecReT6
Protein ID: 15130940
SecReT6 ID896
T6SS typei3
Gene symbolrhs1
Locus tagrhs1
StrainSalmonella enterica subsp. enterica serovar Typhimurium SR11
Repliconchromosome [GenBank: AJ320483] [Browse all T6SS(s) in this replicon]
Location [Strand]28195..31791 [+]
ProductRhs1 protein
NotePAAR
UniProt IDQ93IR1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 384..425
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 410..445
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 474..492
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 518..555
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 582..619
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 631..660
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 676..697
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 682..717
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 723..754
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 815..832
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 823..851
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 866..885
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 890..923
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 953..960
RHS_repeat [PF05593], Evalue: 1.00E-30, Aligned region: 977..999
PAAR_motif [PF05488], Evalue: 2.40E-15, Aligned region: 71..140
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 549..566
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 576..594
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 700..718
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 874..884
RHS [PF03527], Evalue: 4.10E-08, Aligned region: 979..1011
Protein Sequence: 1198 a.a.     [Download]
>gi|15130940|ref|CAC48222.1| Rhs1 protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIGRS
IHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSENIYINSQPAARKDDHTECDAVIED
GSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELV
GMAVGEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLRDD
DEHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLLFM
ETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTRGNLVEYRYDDNGQLTGVV
NRAGTQVRQFAYENGLMTAHSNATGFTCRYRWQELDGAPRVTEHDTSDGEHYRFDYDFAAGTTTVTGRQG
ETWQWWYDRETYITAHRTPGGGMYRFTYNEDHFPVNIELPGGRTVAYEYDIQNRVVKTTDPEGRVTQTQW
NGEFDEITRTALDDDAVWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTQGGVRRETQQR
DALGRLLRTENEHGQRTFSYNRLDQITAVTLTPTEAGQQQHRMQADTVRFEYDRSGWLTAEHAGNGSICY
QRDALGNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYERDSLHRQIMRTQGQLATYSGYDDDGLL
SWQRSLASGSAPVLPGQRPARQGCVTSRDYYWNNHGEVGTIDDGLRGSVVYSYDRSGYLTGRSGQMYDHD
RYYYDKAGNLLDNEGQGAVMSNRLPGCGRDRYGYNEWGELTTRRDQQLEWNAQGQLTRVISGNTETHYGY
DALGRRTRKATYGRHTGHTARSRTDFVWEGFRLLQENVQQQGWRTYLYDAEQPYTPVASVTGRGESRQVW
YYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAYFHQPLRLPGQYFDDETGLHYNLFRYYAP
ECGRFVSQDPIGLRGGLNLYQYAPNPLKYIDPLGLTATVGRWMGPAEYQQMLDTGTVVQSSTGTTHVAYP
ADIDAFGKQAKNGAMYVEFDVPEKSLVPTNEGWAKIVGPDSIEGRLAKRKGLPVPEMPTAENITVRGEKI
NGEVEAKC
 
Nucleotide Sequence: 3597 bp     [Download]
>gi|15130915|gb|AJ320483|rhs1|:28195-31791
ATGTATGAAGCAGCCCGTGTGGATGATCCTATCTACCACACCAGCGCGCTCGCCGGGTTTCTTATCGGCG
CTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGCCGGGCT
GATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGGCGCTCC
ATCCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGGCGGCGC
GCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAAGGGTCGGAAAA
TATCTACATCAACAGCCAGCCCGCCGCCCGTAAGGATGACCACACCGAATGCGACGCGGTGATTGAAGAC
GGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTCCGGACT
GGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGCGTGGCG
GCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAGCTTGTC
GGGATGGCCGTGGGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGCAGAAAA
TCCTGCTGCCGGAAACGGACTTCACCCTGCCCGGTCGCCTGCCGGTCACCTGCTCGCGTTTTTACGCCAG
CCACCTGGAAACTGTGGGACTGTTGGGACGGGGCTGGCGGCTGAACTGGGAAACCAGCCTGCGCGATGAC
GATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAACGATGCTGACGCCCG
GCCACCAGATATTTGACCCGGAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGTGCTGCA
TTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTGTTTATG
GAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCTCCAGCA
GCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGAACTGGT
GCAGGGCGGCACCCGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGCGTGGTG
AACCGGGCGGGAACGCAGGTGCGTCAGTTTGCTTATGAAAACGGGCTGATGACGGCGCACAGCAATGCGA
CGGGGTTCACCTGCCGCTACCGCTGGCAGGAACTCGACGGCGCGCCGCGCGTGACGGAGCACGACACCAG
TGACGGCGAACATTACCGCTTTGACTATGATTTTGCCGCAGGCACCACCACCGTCACCGGCAGGCAGGGG
GAGACATGGCAGTGGTGGTACGACAGGGAAACGTATATCACCGCGCACCGGACGCCGGGCGGTGGAATGT
ACCGCTTCACGTACAACGAAGACCACTTCCCTGTCAACATTGAGCTGCCCGGCGGTCGCACGGTGGCGTA
TGAATATGACATCCAGAACCGGGTGGTGAAGACGACAGATCCGGAAGGCCGGGTGACGCAGACGCAGTGG
AACGGCGAGTTCGACGAAATCACGCGCACGGCGCTGGACGATGACGCTGTCTGGAAAACGCAGTACAACG
CCCACGGCCAGCCAGTGCAGGAGACGGACCCGGAAGGGCGGGTGACGCAGTACGCTTACGATGAACAGGG
GCAGATGTGCAGCCGGACGGATGCGGCGGGCGGCACGCAGGGCGGCGTGCGGCGGGAGACGCAGCAGCGG
GATGCGCTGGGCCGTCTGTTACGGACGGAGAATGAACACGGCCAGCGGACGTTCAGCTACAACCGGCTGG
ACCAGATAACGGCAGTGACGCTCACGCCCACGGAGGCGGGGCAACAGCAGCACCGGATGCAGGCCGACAC
GGTGCGTTTTGAGTATGACCGCAGCGGCTGGCTGACGGCGGAGCACGCGGGGAACGGTAGCATATGTTAT
CAGCGCGACGCGCTGGGCAACCCGACGGACATCACGCTGCCGGACGGGCAGCACCTGACGCATCTGTATT
ACGGGAGCGGGCATCTGTTACAGACGGCGCTGGACGGCCTGACGGTGAGCGAGTATGAGCGCGACAGCCT
GCACCGTCAGATAATGCGCACGCAGGGGCAGCTTGCGACGTACAGCGGCTATGACGACGACGGGCTGCTG
AGCTGGCAGCGCAGTCTGGCGTCCGGCAGTGCCCCTGTTCTTCCTGGCCAGCGCCCGGCGCGGCAGGGCT
GCGTGACGTCGAGGGACTATTACTGGAACAACCACGGCGAGGTGGGCACGATTGACGACGGCCTGCGTGG
CAGCGTGGTGTACAGCTATGACAGAAGCGGTTACCTGACCGGGCGCTCAGGTCAGATGTATGACCATGAC
CGTTATTATTACGATAAGGCGGGCAACCTGCTGGATAACGAAGGGCAGGGAGCGGTGATGAGCAACCGGC
TGCCGGGCTGTGGTCGTGACCGTTACGGCTATAACGAGTGGGGCGAGCTGACCACGCGGCGCGACCAGCA
ACTGGAGTGGAACGCGCAGGGGCAGCTGACGCGGGTCATCAGCGGCAACACGGAGACGCACTACGGCTAC
GATGCGCTGGGGAGGCGAACCCGCAAGGCGACGTACGGGCGGCACACGGGCCATACGGCGCGGAGCCGGA
CGGACTTTGTGTGGGAGGGGTTCAGGCTGTTGCAGGAGAACGTGCAGCAGCAGGGCTGGCGGACCTATCT
GTACGATGCGGAACAGCCGTACACGCCGGTGGCGAGCGTGACGGGGCGGGGAGAAAGCAGGCAGGTGTGG
TATTACCACACGGATGTGACGGGCACGCCGCAGGAGGTGACGGCGGCGGACGGAACGCTGGTGTGGGCGG
GGTATATCAGGGGGTTTGGAGAGAATGCGGCGGACATCAGCAACAGCGGGGCGTACTTTCACCAGCCGCT
GCGGCTGCCGGGGCAGTATTTTGACGACGAGACAGGGCTGCATTACAATCTGTTCAGATATTATGCACCG
GAGTGTGGACGGTTTGTCAGTCAGGATCCGATCGGGCTGAGGGGCGGGTTAAACCTTTATCAGTATGCGC
CAAATCCTCTCAAATATATAGACCCACTTGGTTTAACCGCGACTGTTGGGCGATGGATGGGGCCTGCGGA
ATATCAGCAAATGCTTGATACTGGGACAGTAGTACAAAGTTCAACAGGGACAACTCATGTTGCCTACCCT
GCTGATATAGATGCTTTTGGTAAGCAAGCAAAAAATGGTGCTATGTATGTTGAATTTGATGTGCCTGAAA
AATCATTAGTACCTACAAATGAAGGATGGGCAAAAATAGTAGGGCCAGATTCTATCGAAGGGCGATTAGC
TAAACGCAAAGGTTTGCCTGTTCCTGAAATGCCAACAGCAGAAAACATAACTGTAAGGGGCGAGAAAATT
AATGGGGAAGTTGAAGCAAAATGCTAA
 Primer design