SecReT6
Protein ID: 152969895
SecReT6 ID213
T6SS typei2
Gene symbol-
Locus tagKPN_01342
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]1505225..1508599 [+]
Producthypothetical protein
NoteTssM
UniProt IDA6T853
KEGG IDkpn:KPN_01342
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.00E-69, Aligned region: 399..717
IcmF-related [PF06761], Evalue: 3.00E-69, Aligned region: 788..805
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 233..281
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 840..960
Protein Sequence: 1124 a.a.     [Download]
>gi|152969895|ref|YP_001335004.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MTFIVWKHPDMAGLEGDSQQQNYWLIGGCCITGCIFIMLVMLLWTARSAGKKEFEALLDVTRGDDNKRKD
ESENISVSPAVVMCARIRDHLRTRIGIHWRRKVRLLLVTGDEAAIEQLVPGLRQQHWLEGNRTVLIYGGS
LASEPDREKYIALRKLRRGRPLDGIVRVMPSSLTLTPQISESDLRGLEKISELLGYAAPVWLWKLCDSEW
PQADRAVQAVGVSFPLRATEEDVARQLAQMLPTLREQGMHQIAADTRHDFLLRLGQQLIDGEIAQWRRQL
APWLTASRQRLALRGLMFSLPEPRTVDPYQETDTSPAGQPHLLTLPVTWQGIVDDCRRLRGHHVGMAWER
GLACGLLAILGLWAAGLLLSFALNYSHIASVAGKARDLMAHPSVSDYQLTALHALRNEAGRLVHDGQKGA
PWYRRFGLDHHQQLLNAVLPWYGVANHRLIRDPANAALQQALSALVNSAPNSDQRARLAKPGYDQLKAWL
MMARPDKADGAFFALTMKTVQPTRMGISTGLWQSLAPDLWAFYLSLLPERPEWKIIPDAQRVSQSRQVLL
QQLGRRNAESTLYENMLKSVRRNFADVSLEDMTSGTDARRLFTTDEVVPGMFTRQAWEGGIQQAIDKAAS
SRREEIDWVLSDSRKTVSTDLSPEALKARLTRRYFTDFAGSWLNFLNSLRLNPATNIADVTDQLTLISDV
RQSPLIALMNTLAWQGQAGQQREGLSDSLIKSAKDLVGGKDKPVIDQSAAGPQGPLDDTFGPLLQLMGKN
TGSNVMSADSTLSLQTYLTLITRVRLRLQQVANATDPQEMMQTLAQTVFQGKSVDLTDTQQYGSLISASL
GEEWSGFGNTLFVQPLTQAWETVLLPSAASLNDKWRRSVVANWHTAFDGRFPFAASKSDASLPMLAEFVR
KDSGRIERFLTTELNGVLHKEGSQWVPDKVNSHGLVFNPAFLRAINQLSQLSDILFTDGSQGISFELQAR
PAPEVVETQLTIDGQKLRYFNQMADWQTFRWPGETYKPGTLLTWTTVNAGTRLFGDYSGTWGFIRWLEQG
KRHPLDRSQWMMSFSAPDGRTLQWVLRSQLGSGPLALLALRGLTLPDQIFTVDAAESAQALTTGVGNSDM
DEME
 
Nucleotide Sequence: 3375 bp     [Download]
>gi|152968582|ref|NC_009648.1|:1505225-1508599 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGACATTTATCGTCTGGAAACATCCTGACATGGCCGGACTTGAGGGCGATAGTCAGCAGCAGAATTACT
GGCTTATTGGTGGGTGCTGCATTACCGGATGTATCTTTATCATGTTAGTTATGCTCCTGTGGACAGCTCG
CAGTGCCGGTAAAAAGGAGTTTGAGGCGCTCCTGGATGTCACTCGTGGTGATGACAATAAGAGAAAAGAT
GAGAGTGAAAACATCTCTGTTTCTCCAGCAGTGGTGATGTGTGCCAGGATTCGTGACCATCTGCGAACCC
GAATTGGAATTCACTGGCGGCGCAAAGTCCGCCTGCTTTTAGTCACCGGCGACGAGGCGGCAATCGAACA
ACTGGTGCCTGGCCTGCGTCAGCAGCACTGGCTTGAAGGCAACCGCACCGTGCTGATTTACGGCGGCAGC
CTTGCATCGGAGCCTGACCGAGAAAAATACATCGCGCTGCGCAAGCTGCGCCGCGGTCGTCCTCTGGATG
GGATTGTGCGGGTGATGCCGTCGTCTCTCACCCTGACGCCGCAGATAAGCGAGAGCGACCTGCGCGGGCT
GGAAAAAATCAGCGAACTGCTGGGCTATGCCGCCCCGGTCTGGTTATGGAAACTGTGCGACAGTGAGTGG
CCGCAGGCTGACCGCGCGGTGCAGGCGGTAGGGGTTAGCTTCCCGTTGCGCGCCACTGAGGAAGATGTCG
CCCGTCAGCTTGCGCAGATGTTGCCCACGCTACGGGAGCAGGGGATGCACCAGATCGCAGCGGATACCCG
CCACGACTTCCTGCTGCGTCTGGGGCAGCAGCTTATCGACGGGGAGATCGCACAATGGCGCCGGCAGCTG
GCGCCGTGGCTGACCGCCTCGCGGCAGCGGCTTGCGCTGCGAGGCCTGATGTTTAGCCTGCCAGAGCCTC
GTACCGTAGATCCGTATCAGGAGACGGATACCTCGCCTGCGGGCCAGCCTCATCTCCTGACGCTGCCCGT
CACCTGGCAGGGGATCGTCGATGACTGCCGCCGTTTACGCGGGCATCACGTGGGAATGGCGTGGGAGCGG
GGCCTGGCGTGCGGTCTGCTGGCCATCCTCGGCCTGTGGGCGGCGGGACTGCTGCTCTCCTTTGCCCTCA
ATTACAGTCATATTGCTTCGGTAGCGGGAAAAGCCCGCGACCTGATGGCCCACCCCTCCGTTTCTGACTA
TCAACTGACGGCCCTCCATGCCCTGCGCAATGAGGCCGGCCGTCTCGTGCACGATGGGCAGAAGGGAGCA
CCCTGGTATCGGCGCTTTGGTCTGGACCATCATCAGCAACTATTAAACGCCGTCCTACCTTGGTACGGTG
TGGCGAATCATCGCCTGATACGTGACCCGGCCAATGCCGCGTTGCAGCAGGCGCTCAGCGCGCTGGTCAA
CTCCGCCCCCAATAGCGACCAACGAGCCAGGCTGGCGAAACCGGGCTATGACCAGCTGAAAGCCTGGCTG
ATGATGGCTCGTCCGGATAAAGCCGATGGCGCATTTTTCGCGCTGACCATGAAAACGGTCCAGCCGACGC
GAATGGGGATCTCGACCGGTCTGTGGCAAAGTCTGGCGCCGGATTTGTGGGCCTTTTATCTCTCCCTGCT
GCCCGAGCGGCCAGAGTGGAAGATCATCCCGGATGCGCAACGGGTGAGTCAGAGCCGTCAGGTTCTGTTG
CAGCAGCTAGGTCGCCGCAATGCCGAAAGCACCTTATATGAGAACATGCTCAAATCCGTGCGTCGTAATT
TTGCCGATGTGTCGCTGGAAGACATGACCAGTGGCACCGACGCGCGCCGCCTGTTTACCACCGATGAAGT
GGTCCCGGGGATGTTTACCCGCCAGGCATGGGAAGGCGGCATTCAGCAGGCCATTGATAAGGCAGCCAGC
TCGCGCCGGGAGGAAATCGACTGGGTGCTGAGCGATTCGCGCAAAACGGTGTCGACAGACCTGTCGCCGG
AGGCGCTGAAAGCGCGTCTGACCCGACGCTACTTCACCGATTTCGCCGGCAGCTGGCTGAATTTTCTCAA
CAGTCTGCGACTTAATCCGGCGACCAATATCGCCGATGTTACCGACCAGCTCACGCTGATTAGCGATGTC
CGCCAGTCGCCGCTGATTGCCCTGATGAATACCCTCGCCTGGCAGGGGCAGGCGGGGCAACAAAGGGAGG
GGCTGTCGGACAGCCTTATTAAATCGGCCAAAGATCTGGTGGGCGGGAAAGACAAGCCGGTCATCGACCA
GTCGGCAGCCGGCCCGCAGGGGCCTCTGGATGACACGTTCGGCCCACTGCTCCAGCTGATGGGGAAAAAC
ACGGGCAGCAACGTCATGTCGGCCGATAGCACCCTGAGCCTGCAAACCTATCTGACCCTTATCACCCGCG
TGCGCCTGCGCCTGCAGCAGGTTGCGAATGCCACCGATCCGCAGGAGATGATGCAGACCCTGGCGCAGAC
CGTCTTCCAGGGGAAAAGCGTCGACCTGACCGACACGCAACAGTACGGCAGCCTGATTTCGGCAAGCCTT
GGCGAAGAGTGGAGTGGCTTCGGTAATACTCTGTTTGTGCAGCCGCTGACTCAGGCCTGGGAAACCGTGC
TTCTGCCGTCGGCGGCCAGTCTGAATGACAAATGGCGCCGATCGGTGGTCGCCAACTGGCACACCGCCTT
TGACGGACGCTTTCCGTTTGCCGCCAGCAAAAGCGACGCCTCGCTGCCGATGCTGGCTGAGTTTGTGCGC
AAGGACAGCGGGCGGATCGAACGTTTTCTCACGACGGAGCTGAACGGTGTCCTGCATAAAGAAGGCAGTC
AGTGGGTGCCGGATAAGGTCAACAGTCACGGCCTGGTCTTTAATCCGGCCTTTCTGCGCGCCATCAACCA
GCTAAGCCAGCTGTCCGACATTCTTTTCACCGACGGAAGCCAGGGGATCAGCTTTGAGTTACAGGCCAGG
CCTGCCCCGGAGGTTGTCGAGACACAGCTGACGATAGACGGCCAAAAGTTGCGCTATTTCAATCAGATGG
CCGACTGGCAGACTTTCCGCTGGCCGGGGGAGACGTATAAACCCGGTACTCTGCTTACCTGGACCACCGT
CAATGCGGGCACGCGCCTGTTCGGTGACTACAGCGGCACCTGGGGTTTTATTCGCTGGCTGGAGCAGGGT
AAACGCCATCCGCTGGATCGCAGCCAGTGGATGATGAGCTTCTCCGCCCCGGATGGCCGCACCCTGCAGT
GGGTATTGCGCTCCCAGCTTGGGAGCGGCCCGTTGGCGCTTCTGGCGCTGCGCGGATTGACCCTGCCGGA
TCAGATTTTCACTGTCGATGCGGCTGAGAGCGCACAGGCCCTGACGACGGGGGTAGGGAATAGTGACATG
GATGAGATGGAATAA
 Primer design