SecReT6
Protein ID: 152970798
SecReT6 ID214
T6SS typeN/A
Gene symbol-
Locus tagKPN_02251
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]2467510..2470920 [-]
Producthypothetical protein
NoteTssM
UniProt IDA6TAQ6
KEGG IDkpn:KPN_02251
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.80E-78, Aligned region: 416..734
DUF1215 [PF06744], Evalue: 2.00E-34, Aligned region: 632..681
DUF1215 [PF06744], Evalue: 2.00E-34, Aligned region: 855..973
Protein Sequence: 1136 a.a.     [Download]
>gi|152970798|ref|YP_001335907.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MIIPGNGLGRFGLAGLTLAGMAAIWWGITRYGGMLNINTRGEQVLAFVQVCLALVFVFYLPAMSRRVKES
LYRRQSQQASVLPGEEGRVALTPPHHITVGEIRQTLRYQYGRAWSRKVRILLIIGSVRDVEQLTPKLTQE
LWQEDQGTLLLWGGDPGAAVDNAWFTALRKLRYRPADGMVWITSGFDGVLTTMNRTKPRLTPDEMDSVSH
SLKLRFEAIGWKLPLYVWSLYEGGNEKNGRITQPVGCLLPAGCTPQIVAEQFTALASLLIEQGIQQICGQ
PQHNFLLALADQLTREAEAVVEPLSILLNPYRPLPMAGVVFSEASVEAGRSVRHHWGRDNRWETIPDSVL
WLPAGLRPRKQGVNWMRGMSVAAAALMLLWAASMTVSFIANRHLVAIAQEQVRLASAEKQPLAVRLHALS
ALQKTLSQLEYRSQHGAPWYARGGLSQNDDLLAALFPRYGEMAQPLLRDAAAHHLEEQLTAFVQLPPDSP
LREKMTKTAYGQLKQYLMLTRPEKMDAAWFATTLMQDWPQRSGIADAVWQGSGPSLLAFYAASLVSHPQW
RLPVDDGLVSQVRTRLIRQMGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGMFT
RQAWEQAVQPAIEKVVAERRDEMDWVLSDTKQTAAQSTSPEALRARLAERYFADFSGSWLDFLNSLRWQR
AATLSDAIDQLTLMADVRQSPLVALMNTLSVQGRTGQTGEAIADSLVKSARQLFNRDNSPVIDQRSGARG
PLDATFGPVLALLDNRDGGPPTSRLSLQTFLTRITQVRLRLQQVTNATDPQAMTRLLAQTVFQGKAVDLT
ETRDYGSLVAAGLGQQWSGFGQTLFVRPMEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKNTS
SEVSLPLLAKYLDSETGRIARFLQTRLNGVLHKEGSRWMADSINAQGLTFNPAFLEAMNTLSHLSDVAFA
NGEAGLHFALRPGTADGVMQTELVIDSQKLVYMNQMPVWRRFSWPADTEAPGASLSWVSTRAGTRQYGDF
PGAWGWIRLLDKAVVSAYPGTSSSWSLSWKAPDGLLLNYTLRTEAGEGPLALLALRNFTLPETIFSVRAS
AECVPLTDDIPGEEGY
 
Nucleotide Sequence: 3411 bp     [Download]
>gi|152968582|ref|NC_009648.1|:c2470920-2467510 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
ATGATTATACCGGGTAATGGCCTGGGCCGGTTTGGCTTGGCCGGGCTTACGTTGGCCGGGATGGCTGCAA
TATGGTGGGGGATCACCCGCTATGGCGGCATGCTGAATATCAATACGCGGGGCGAGCAGGTACTGGCGTT
TGTCCAGGTCTGTCTGGCGTTGGTATTTGTTTTTTACCTTCCTGCAATGTCCCGCCGTGTGAAGGAGAGT
TTATATCGCCGGCAGTCGCAGCAGGCCAGCGTCTTACCCGGCGAAGAAGGGCGCGTGGCGCTGACACCTC
CCCATCATATTACGGTGGGGGAAATTCGCCAGACTCTACGCTATCAGTATGGACGCGCCTGGTCCCGCAA
AGTCCGTATTCTGCTGATAATTGGCTCAGTCAGAGACGTAGAACAACTGACCCCAAAGCTCACGCAGGAA
CTCTGGCAGGAAGATCAAGGTACATTATTGCTGTGGGGTGGAGACCCTGGGGCAGCGGTAGATAACGCCT
GGTTCACAGCGCTGCGTAAACTGCGTTATCGCCCGGCTGATGGTATGGTGTGGATAACATCGGGCTTTGA
CGGCGTTTTGACAACGATGAACAGAACGAAGCCCAGGCTCACGCCAGATGAAATGGACAGTGTGTCTCAC
TCTCTAAAGCTACGCTTCGAAGCTATTGGCTGGAAACTACCCCTATACGTCTGGTCGCTGTATGAGGGGG
GCAACGAAAAAAATGGACGTATCACTCAGCCTGTAGGCTGCCTGTTACCTGCAGGTTGTACGCCGCAAAT
AGTTGCCGAACAGTTCACTGCCCTGGCGTCGTTACTGATAGAGCAGGGCATCCAGCAGATATGCGGGCAA
CCACAGCACAATTTTTTACTCGCGCTGGCCGACCAGTTGACTCGGGAAGCGGAAGCGGTGGTGGAACCGT
TATCGATACTGCTTAATCCATACCGACCATTGCCGATGGCCGGGGTGGTATTTAGTGAGGCGTCAGTAGA
GGCTGGTCGCAGTGTCCGTCATCACTGGGGACGGGATAACCGCTGGGAAACGATACCAGACTCAGTGCTG
TGGTTGCCAGCCGGTCTACGTCCGCGCAAACAGGGAGTCAACTGGATGCGTGGGATGAGCGTGGCCGCCG
CCGCCCTGATGTTACTCTGGGCCGCCTCAATGACAGTCTCTTTTATCGCCAACCGCCACCTGGTGGCGAT
CGCACAGGAGCAGGTGCGGCTGGCCTCAGCGGAGAAACAGCCGCTGGCCGTACGCCTGCATGCGCTCTCC
GCGTTACAGAAAACGCTTTCTCAACTGGAATACCGCTCGCAGCACGGCGCGCCGTGGTATGCCCGCGGCG
GTCTCAGCCAGAATGATGACCTGCTGGCGGCGCTGTTTCCGCGCTACGGGGAGATGGCGCAACCGCTGCT
GCGCGATGCGGCGGCGCATCATCTGGAAGAGCAGCTCACCGCCTTCGTGCAGCTGCCGCCGGACAGCCCA
CTGCGTGAGAAGATGACGAAGACCGCTTACGGACAACTGAAACAATATCTGATGTTGACCCGCCCGGAAA
AAATGGACGCCGCGTGGTTCGCCACTACGCTAATGCAGGACTGGCCGCAGCGCTCAGGCATCGCCGACGC
CGTCTGGCAGGGCAGCGGCCCTTCGCTGCTGGCATTTTATGCCGCCAGTCTGGTGTCGCATCCGCAGTGG
CGTCTGCCTGTCGATGATGGTCTGGTCAGCCAGGTGCGCACACGGTTAATTCGACAGATGGGCCAGCGCA
ACAGTGAGTCCACGCTTTACCAGAAGATGCTCGCGCAGGTGGCGAATCAGTATGCCGATATGCGCCTGGC
GGATATGACTGCCGACACCGATGCTTCGCGTCTGTTCAGCACTGATGAGGTGGTGCCGGGCATGTTTACC
CGTCAGGCCTGGGAGCAGGCCGTGCAGCCGGCCATTGAGAAAGTGGTCGCGGAACGCCGCGATGAAATGG
ACTGGGTGTTGAGCGATACGAAGCAGACTGCCGCGCAGTCGACGTCGCCGGAAGCTCTGCGAGCCAGGCT
GGCGGAGCGTTATTTCGCTGATTTCAGCGGCTCCTGGCTGGATTTCCTCAACAGTCTGCGCTGGCAGCGC
GCGGCGACCCTCTCCGATGCTATCGACCAGCTGACCCTGATGGCCGATGTGCGCCAGTCGCCGCTGGTGG
CGCTGATGAACACCCTGAGCGTGCAGGGGCGAACCGGCCAGACCGGGGAAGCCATCGCCGATTCGCTGGT
CAAATCGGCCAGGCAGCTGTTTAACCGTGATAACTCGCCCGTCATCGATCAACGGTCCGGCGCGCGCGGT
CCTCTGGATGCCACCTTCGGACCCGTGCTGGCGCTGCTGGACAATCGCGACGGCGGGCCGCCCACCAGCC
GTCTTAGCCTGCAGACCTTCCTGACCCGCATCACCCAGGTGCGTCTGCGCCTGCAGCAGGTCACCAACGC
CACCGACCCGCAGGCGATGACCCGCCTGCTTGCGCAGACGGTATTCCAGGGCAAGGCCGTGGATTTAACC
GAAACGCGCGACTACGGCAGCCTGGTGGCGGCGGGGCTGGGCCAGCAGTGGAGTGGATTTGGGCAAACGC
TTTTTGTTCGCCCGATGGAACAGGCCTGGCAGCAGGTGCTGACCCCGGCGGCGGAAAGTCTCAACGCCCA
GTGGCGCAGCGCGGTGGTGGAGGACTGGAATAGCGCCTTTGGCGGCCGCTACCCCTTTAAAAATACCAGC
AGTGAAGTCTCTCTGCCGCTGTTGGCAAAATACCTCGACAGCGAGACCGGGCGCATCGCCCGCTTTCTGC
AGACCCGGCTGAACGGCGTGCTGCATAAAGAGGGGAGCCGCTGGATGGCGGACAGTATCAATGCTCAGGG
GCTGACGTTTAACCCGGCCTTTCTGGAGGCGATGAATACCCTGAGCCATCTCTCCGACGTCGCGTTCGCC
AACGGCGAAGCGGGATTGCATTTTGCGCTTCGCCCCGGCACGGCGGACGGCGTGATGCAGACGGAGCTGG
TCATTGACAGTCAGAAACTTGTCTATATGAACCAGATGCCGGTCTGGCGGCGGTTCAGCTGGCCCGCTGA
CACCGAAGCGCCGGGCGCCAGTCTGAGCTGGGTCAGTACCCGGGCGGGCACCCGCCAGTATGGCGATTTC
CCGGGCGCCTGGGGGTGGATCCGTCTGCTGGATAAGGCGGTGGTCAGCGCTTATCCCGGAACGAGCAGCA
GCTGGAGCCTGAGCTGGAAAGCGCCGGATGGTCTGTTGCTGAACTACACGCTGCGTACCGAGGCGGGGGA
AGGACCGCTGGCGCTGTTGGCGCTGCGAAACTTTACGCTACCGGAGACGATATTCAGCGTGCGCGCGTCT
GCTGAATGTGTTCCGCTGACCGACGATATACCCGGCGAAGAGGGATACTGA
 Primer design