SecReT6
Protein ID: 152971694
SecReT6 ID215
T6SS typeN/A
Gene symbol-
Locus tagKPN_03175
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconchromosome [GenBank: NC_009648] [Browse all T6SS(s) in this replicon]
Location [Strand]3487423..3490500 [+]
Producthypothetical protein
NoteTssM
UniProt IDA6TDA2
KEGG IDkpn:KPN_03175
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.30E-69, Aligned region: 306..623
IcmF-related [PF06761], Evalue: 2.30E-69, Aligned region: 684..731
DUF1215 [PF06744], Evalue: 1.20E-36, Aligned region: 339..373
DUF1215 [PF06744], Evalue: 1.20E-36, Aligned region: 748..867
Protein Sequence: 1025 a.a.     [Download]
>gi|152971694|ref|YP_001336803.1| unnamed protein product [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MYSELFFHLRDRYGLFWQRQVRLLLVTGEPEQVEAIAPGLTEQRWQEGDHTVLIYGGKASAEPDTTLLAS
LKKLRRFRPLDGIIWPLTEKQSCQTAQLDKGWRELGNGGKLLGFQAPLYLWQVCDDGGYQAGRTLQSVGC
LLPERSTPEQLATQLEAQTPQLTEQGMSQLLTNNRHDFLLRLAHTLTERGIAHWQTVLKPLLAGGAFPSL
HLRGLMFSPPLAAVPEAAPHAWLSSLVWAGVTGDNAKGRTVGFPWLRTALMACFCVLAIWWTGMMTSFFA
NRALIQETGTHTARAINTRLPLAEQLVALHTLQGELERLQYRIRHGTPWYQRFGLERNAQLLNTAFPGYA
QAANRLVRDVAVAHLQQQLNAFVALSPNSPQRTATGELRYKQLKALLMTSRPEKADAAFFSTTLMADNLR
YADVTEGTRQSVLPSLLTFWMANLPEHPQWKIAPQPELVGAVRKILLRQIGVRNAENTLYQNVLKQVSRN
YADMTLADMTGDAQAGSLFGTEQTVPGMFTRQAWEGQVKEAIEQVVTARREEIDWVLSDRQQDASADISP
EALRTRLTERYFTDFAGSWLTFLNSIRWKKEDSLSGVLDQLTLMADARQSPLIALTDTVAWQAAAGRESR
SLSDSLTQSAKELFNGKEKTPQNTRAAREEEAPTGPMDKTFAPLLRLTGDKAGGTGDSQLSLQTYLTRVT
RVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASLGEEWSGFGQSLFVRPVEQAWRQ
VLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKDTPNDASLPLLAKYLRDDGRISQFIATNLAGVLEREGR
YWVADTMNTQGLTVNPAFLRALNRLRDVADTAFASGDAGVHFELMAKPARDVMKTHLVIDGQQLEYFNQK
ERWQRFSWPDEQWQPGASLSWTSTQNMERILADFRGSWSFIRLLEQAQVTQLDSSSFMLQWQAPDGLPLH
YLMRVEQGKGPLALLALKNYRLPGQVFLTGKAISDAEEYRDNADE
 
Nucleotide Sequence: 3078 bp     [Download]
>gi|152968582|ref|NC_009648.1|:3487423-3490500 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 chromosome, complete genome
TTGTATTCTGAACTATTTTTTCATCTTCGCGACCGTTACGGTCTGTTCTGGCAGCGTCAGGTCCGTCTGC
TGCTGGTGACGGGCGAGCCTGAGCAGGTGGAAGCCATCGCGCCGGGGCTGACAGAGCAGCGCTGGCAGGA
AGGCGACCATACGGTGTTGATATATGGCGGCAAGGCGTCGGCAGAGCCGGATACCACCCTGCTGGCCTCC
CTGAAAAAACTGCGCCGCTTCCGCCCGCTGGACGGTATTATCTGGCCGCTGACGGAGAAACAGAGTTGCC
AGACGGCGCAACTGGATAAGGGCTGGCGCGAACTGGGTAATGGTGGAAAATTGCTTGGCTTTCAGGCTCC
GCTGTATCTGTGGCAGGTCTGTGATGACGGAGGTTATCAGGCCGGGCGCACACTACAAAGCGTCGGCTGC
CTGCTGCCGGAGCGAAGCACACCGGAACAACTGGCTACACAACTGGAAGCACAGACCCCGCAACTGACGG
AACAGGGAATGTCGCAGTTGCTGACCAATAACCGGCACGATTTTCTGTTGCGTCTTGCCCACACACTTAC
AGAGCGCGGCATCGCTCACTGGCAAACCGTCCTGAAGCCCTTGCTGGCAGGCGGCGCATTCCCTTCTCTG
CACCTGCGCGGCCTGATGTTCAGCCCTCCACTGGCCGCCGTGCCGGAAGCGGCTCCCCACGCGTGGCTGT
CATCGCTGGTGTGGGCGGGCGTTACTGGCGACAATGCAAAAGGCCGCACCGTGGGCTTTCCGTGGCTGCG
CACCGCGCTGATGGCCTGCTTCTGCGTGCTGGCGATATGGTGGACCGGAATGATGACCTCGTTCTTTGCC
AACCGCGCCCTGATTCAGGAAACCGGGACGCACACAGCGCGGGCCATCAATACCCGACTGCCGCTGGCAG
AGCAACTGGTTGCGCTGCACACCTTGCAGGGCGAGCTCGAGCGTCTGCAGTATCGTATCCGCCACGGTAC
GCCGTGGTATCAGCGTTTCGGTCTGGAGCGTAATGCTCAGTTGCTGAACACGGCGTTCCCCGGCTATGCG
CAGGCGGCAAACCGACTGGTACGCGATGTAGCGGTCGCCCACCTGCAGCAGCAACTGAACGCCTTTGTCG
CCCTGTCTCCGAACAGTCCGCAACGCACCGCAACGGGAGAACTGCGTTATAAGCAACTGAAGGCGCTGCT
GATGACGTCCCGTCCCGAAAAAGCCGACGCCGCCTTTTTCAGTACCACGCTGATGGCAGATAACCTGCGC
TATGCAGATGTAACGGAAGGTACCCGGCAAAGCGTGCTGCCGTCGCTGCTGACCTTCTGGATGGCGAATC
TGCCGGAGCATCCACAGTGGAAAATCGCCCCGCAGCCGGAACTGGTCGGCGCGGTACGCAAAATTCTGCT
GCGCCAGATTGGGGTGCGCAATGCGGAAAATACCCTCTATCAGAACGTCCTGAAACAGGTCTCCCGCAAC
TACGCCGATATGACGCTGGCGGATATGACCGGCGACGCGCAGGCCGGCTCGTTGTTTGGTACTGAGCAAA
CGGTGCCGGGAATGTTCACCCGCCAGGCATGGGAAGGTCAGGTTAAGGAGGCCATAGAGCAGGTGGTGAC
GGCCCGACGTGAGGAAATCGACTGGGTACTCAGCGACCGTCAACAGGACGCTTCCGCCGATATTTCGCCG
GAAGCCCTGCGTACCCGCCTGACGGAACGTTACTTCACCGACTTCGCCGGAAGCTGGCTGACATTCCTCA
ATAGCATTCGCTGGAAGAAAGAGGACTCGCTGTCCGGCGTGCTGGACCAACTGACGCTGATGGCCGATGC
CCGCCAGTCGCCGCTGATTGCGCTCACGGATACGGTGGCATGGCAGGCGGCGGCAGGAAGGGAAAGCCGT
AGTCTGTCAGACTCGCTGACACAATCAGCAAAAGAGTTGTTTAACGGTAAAGAAAAAACACCGCAGAACA
CCCGTGCCGCCCGTGAAGAAGAAGCACCAACGGGACCGATGGACAAAACCTTTGCCCCGCTGCTGCGGCT
GACCGGTGATAAAGCCGGAGGCACTGGCGACAGCCAGCTCAGTCTGCAAACTTACCTCACCCGCGTGACC
CGCGTGCGCCTCAAGCTGCAACAGGTCACCAACGCCCCGGACCCGCAGGAGATGACGCAGCAGCTGGCGC
AGACGGTATTGCAGGGCAAAACCGTCGACCTCACCGATACCCGAGATTATGGCCGTCTGATAGCCGCCAG
TCTGGGCGAGGAATGGAGCGGCTTCGGCCAGTCGCTGTTTGTTCGTCCGGTGGAGCAGGCGTGGCGGCAG
GTGCTGACGCCCGCAGCGGACAGTCTGAACCGGCAGTGGCAGCGGGCCATTGTCAGCCACTGGAATCAGG
ATTTCGCCGGGCGTTATCCGTTTAAGGACACTCCGAACGACGCCTCTCTCCCCCTGCTGGCTAAATATCT
GCGCGATGACGGACGTATAAGTCAGTTTATCGCTACCAACCTTGCAGGCGTTCTGGAACGCGAAGGTCGT
TATTGGGTGGCTGACACCATGAACACGCAGGGACTGACGGTCAACCCGGCGTTTTTACGCGCCCTGAATC
GCCTGCGCGATGTGGCCGACACAGCCTTTGCCAGCGGCGATGCCGGGGTACATTTTGAACTGATGGCAAA
ACCGGCACGTGACGTGATGAAAACGCATCTGGTGATTGACGGCCAGCAACTGGAATATTTCAACCAGAAA
GAACGCTGGCAGCGTTTCAGCTGGCCGGATGAGCAGTGGCAGCCCGGCGCATCGCTGAGCTGGACCAGTA
CGCAGAATATGGAACGTATTCTGGCCGACTTCCGGGGAAGCTGGAGCTTTATTCGTCTGCTGGAACAGGC
GCAGGTCACACAGCTGGACAGCAGCAGCTTTATGCTGCAGTGGCAAGCGCCGGACGGTCTGCCGCTGCAT
TACCTGATGCGCGTCGAACAGGGTAAAGGGCCGTTGGCGCTGCTGGCGTTGAAAAACTACCGCCTGCCGG
GACAGGTGTTTCTGACCGGGAAAGCCATAAGTGATGCAGAAGAATACAGGGACAACGCAGATGAGTGA
 Primer design