SecReT6
Protein ID: 152983480
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0155
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]170927..171445 [+]
Producthypothetical protein
NoteTssB
UniProt IDA6UXL6
KEGG IDpap:PSPA7_0155
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.10E-60, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|152983480|ref|YP_001345551.1| hypothetical protein PSPA7_0155 [Pseudomonas aeruginosa PA7]
MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPQAAVADRKFLEIDADNF
DARLKAMKPRVAFNVPNVLTGEGNLSLDITFESMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKT
GAEDMIMKAIKDPALLQALASAPKPKDDEPQA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|152983466|ref|NC_009656.1|:170927-171445 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGGAAGCACTACCAGCAGTCAGAAGTTCATCGCCAGGAACCGGGCGCCACGCGTGCAGATCGAGTACG
ACGTGGAGCTGTACGGCGCCGAGAAGAAGGTCCAACTGCCCTTCGTCATGGGCGTGATGGCGGACCTCGC
CGGCAAGCCCGCCGAGCCCCAGGCGGCGGTCGCCGACCGCAAGTTCCTGGAGATCGACGCGGACAACTTC
GACGCCCGGCTCAAGGCGATGAAGCCGCGGGTGGCCTTCAACGTGCCGAACGTGCTGACCGGCGAAGGCA
ACCTGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAGCCCCGCCGCGGTGGCGCGCAAGGTCGA
CTCGCTGAACAAGCTGCTCGAGGCGCGCACCCAGCTGGCCAACCTGCTGACCTACATGGACGGCAAGACC
GGCGCCGAGGACATGATCATGAAGGCGATCAAGGACCCGGCCCTGTTGCAGGCCCTGGCCAGCGCACCGA
AGCCCAAAGACGACGAGCCGCAGGCGTAA
 Primer design