SecReT6
Protein ID: 152983873
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0169
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]185315..187540 [+]
Producthypothetical protein
NoteTssI
UniProt IDA6UXN0
KEGG IDpap:PSPA7_0169
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-89, Aligned region: 29..329
Gp5_C [PF06715], Evalue: 8.40E-28, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 8.40E-28, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 8.40E-28, Aligned region: 562..584
Gp5_C [PF06715], Evalue: 8.40E-28, Aligned region: 586..608
Gp5_C [PF06715], Evalue: 8.40E-28, Aligned region: 610..632
Gp5_C [PF06715], Evalue: 8.40E-28, Aligned region: 633..656
Gp5_C [PF06715], Evalue: 8.40E-28, Aligned region: 658..675
Gp5_C [PF06715], Evalue: 8.40E-28, Aligned region: 714..723
Phage_base_V [PF04717], Evalue: 8.10E-26, Aligned region: 369..462
Protein Sequence: 741 a.a.     [Download]
>gi|152983873|ref|YP_001345565.1| hypothetical protein PSPA7_0169 [Pseudomonas aeruginosa PA7]
MALAQQTRLVRVDSPLGADVLQLQRMEGREELGRPFAYELELISEDPDLQLDGLLGKPASLALELHDGSR
RHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHILVLSDAYGAHRSPPGYASVPYYPPTLEQRER
DHFYDWHMAREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIE
ALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCI
DGGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRSKTIDHDETVHVKHDRTETVDNNETLTIGVDRTEKVG
NNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETIS
IGADRSESVGANESIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASI
RMKKDGSIVISGKNITIDGSGAINIKADKNVVMKGRKILQN
 
Nucleotide Sequence: 2226 bp     [Download]
>gi|152983466|ref|NC_009656.1|:185315-187540 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGCACTTGCGCAACAGACCCGCCTGGTCCGGGTGGACAGTCCGCTCGGTGCGGATGTCCTGCAACTGC
AGCGAATGGAGGGTCGCGAAGAACTCGGCCGGCCGTTCGCCTACGAGCTGGAACTGATCTCGGAAGACCC
CGACCTGCAGCTCGACGGCCTGCTGGGCAAGCCGGCCAGCCTGGCGCTGGAGCTGCACGATGGCAGCCGG
CGCCACTTCCACGGCATCGTCGCCGCCTGCAGCCAGGGTTCCGGCAATGGCCAGTTCGCCAGTTACCAGG
TCACCCTGCGGCCCTGGCTGTGGCTGCTCACGCGCACCTCCGACTGCCGTATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGATGCCCTGAGTCGCTCC
TATCGCGAATGGGAATACTGCGTGCAGTACCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAGC
AGGAGGGCATCTACTACTGGTTCCGCCACGAGCAGAGCCGTCACATCCTGGTGCTCTCCGACGCCTATGG
CGCGCACCGGAGCCCGCCGGGCTACGCCAGCGTGCCCTACTACCCGCCGACCCTGGAGCAGCGCGAGCGC
GACCACTTCTACGACTGGCACATGGCGCGCGAGGTGCAGTCCGGCTCGCTGAGCCTCAACGACTACGACT
TCCAGCGCCCCGGCGCGCGCCTGGAAGTGCGCTCGAACATCGCCCGTTCGCATGCGGCGGCCGACTACCC
GCTGTACGACTACCCCGGCGAGTACGTGCAGAGCCAGGACGGCGAGCAGTATGCGCGGACCCGCATCGAG
GCGTTGCAGGCGCGTTACGAGCGGGTGCGCCTGCGCGGCCGCGCCCGTGGCCTGGGTTCCGGCCATCTGT
TCAAGCTCAGCGGCTACCCGCGCGAGGACCAGAATCGCGAGTACCTGGTGGTCGGCGCCGAGTATCGGGT
GGTCCAGGAACTCTACGAGACCGGCGGCGGCGGGGTCGGCGCACAGTTCGAGAGCGAGCTGGATTGCATC
GATGGCGGCCAGGCCTACCGCCCCTTGCCGACCACCCCGTTGCCGATCGTCCGCGGCCCGCAGACCGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGATCAGTACGGCCGGGTCAAGGTGCACTTCCACTG
GGACCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATGCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAGGTAATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGGATGAAGAGCCGCTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCACGCGGAGAAGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGATCGCAGCAAGACCATCGACCACGACGAAACCGTGCACGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCCTCACCATCGGCGTCGATCGCACCGAGAAGGTCGGC
AACAACGAGAAGATCAGCATCGGCGCGAACCGCACCGAGGACGTCGGCAGCAACGAGACCATCAGCATCG
GCGTCGACCGCACCGAGAAGGTCGGCAGCAACGAGAAGATCAGCATCGGCGCCAATCGCACCGAGGATGT
CGGCAACGACGAGACCATCAGCATCGGCGCCAACCGCAGCGAGTCGGTGGGCAACAACGAGACGATCAGC
ATCGGCGCCGACCGTAGCGAATCGGTGGGCGCCAACGAGAGCATCGATATCGGCGGCAACCAGAGCACGA
GCATCGGCAAGAACGAGTCGCGCAGCGTCGGCCAGGGCCGCGATACCTCGGTGGGCAAGGACGATAGCCT
GGACGTGGGCAAGAGCTTCACGCTCAATGCCGGCGACTCGATCACTCTGGTCACCGGCGCTGCCAGCATC
CGCATGAAGAAGGACGGCAGCATCGTCATCAGCGGCAAGAACATCACCATCGACGGTTCCGGGGCGATCA
ACATCAAGGCCGACAAGAACGTGGTGATGAAGGGTCGCAAGATTCTCCAGAACTGA
 Primer design