SecReT6
Protein ID: 152984184
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0156
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]171458..172954 [+]
Producthypothetical protein
NoteTssC
UniProt IDA6UXL7
KEGG IDpap:PSPA7_0156
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-195, Aligned region: 67..493
Protein Sequence: 498 a.a.     [Download]
>gi|152984184|ref|YP_001345552.1| hypothetical protein PSPA7_0156 [Pseudomonas aeruginosa PA7]
MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAVRTLAEHALEQTSLISNDAIKSIESI
IAAIDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQ
SPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWA
NSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDFAAFIGAQSLQKPAEYDDPDASANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVS
KLPSAKEA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|152983466|ref|NC_009656.1|:171458-172954 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGCCGAATTGAGCACCGAGAACCTGGCCCAGGGCCAGACCACCACCGAGCAGACCAGCGAGTTCGCCA
GCCTGCTGCTGCAGGAATTCAAGCCCAAGACCGAGCGCGCCCGCGAGGCGGTGGAAACCGCCGTGCGTAC
CCTCGCCGAACACGCCCTGGAGCAGACCAGCCTGATCTCCAACGACGCGATCAAGTCGATCGAGTCGATC
ATCGCGGCGATCGACGCCAAGCTCACCGCGCAGGTCAACCTGATCATGCACCACGCCGACTTCCAGCAGC
TGGAAAGCGCCTGGCGCGGCCTGCACTACCTGGTCAACAACACCGAGACCGACGAGCAACTGAAGATCCG
TGTGCTGAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAGTTCAAGGGCACCACCTGGGACCAG
AGCCCGATCTTCAAGAAGCTCTACGAGGAGGAATACGGCCAGTTCGGCGGCGAGCCCTACGGCTGCCTGG
TCGGCGACTACTATTTCGACCAGTCGCCGCCGGACGTCGAGCTGCTCGGCGAGATGGCGAAGATCTCCGC
CGCGATGCACGCGCCGTTCATCTCCGCCGCCTCGCCGACGGTGATGGGCATGGGTTCCTGGCAGGAACTG
TCCAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGCTCGCTGCGCGAGT
CCGAGGACTCCCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCGCGCCTGCCGTACGGGGCGAAGAC
CGACCCGGTGGAAGAGTTCGCCTTCGAGGAAGAGACCGACGGCGCCGACAGCAGCAAGTACGCCTGGGCC
AACTCGGCCTACGCCATGGCGGTCAACATCAACCGTTCCTTCAAGCTCTACGGCTGGTGTTCGCGGATCC
GCGGCGTCGAGTCCGGGGGCGAGGTGCAGGGCCTGCCGGCGCACACCTTCCCCACCGACGACGGCGGCGT
GGACATGAAATGCCCGACCGAGATCGCCATTTCCGACCGTCGCGAGGCGGAGCTGGCGAAGAACGGCTTC
ATGCCGCTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGCGCGCAGTCGCTGCAGAAACCCG
CCGAGTACGACGATCCGGACGCCAGCGCCAACGCCAACCTGGCGGCGCGCCTGCCCTACCTGTTCGCCAC
CTGCCGCTTCGCCCACTACCTGAAGTGCATCGTTCGCGACAAGATCGGCTCGTTCAAGGAGAAGGACGAG
ATGCAGCGCTGGCTGCAGGACTGGATCCTCAACTATGTCGACGGCGACCCGGCTCACTCCACCGAGACCA
CCAAGGCCCAGCACCCGCTGGCGGCGGCCGAGGTGGTGGTGGAGGAAGTCGAAGGCAACCCGGGTTACTA
CAACTCGAAGTTCTTCCTTCGCCCGCACTACCAGCTCGAGGGACTGACTGTATCGCTACGCCTGGTATCC
AAGCTGCCTTCGGCCAAAGAGGCCTGA
 Primer design