SecReT6
Protein ID: 152984195
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0159
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]174464..174973 [+]
Producthypothetical protein
NoteTssE
UniProt IDA6UXM0
KEGG IDpap:PSPA7_0159
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-23, Aligned region: 36..145
Protein Sequence: 169 a.a.     [Download]
>gi|152984195|ref|YP_001345555.1| hypothetical protein PSPA7_0159 [Pseudomonas aeruginosa PA7]
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASVLRDLAWLFNTTSLFDHDLAARMPAGN
SVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAE
PAPLRLLLTTNLDLETGHVRVAQGERRRA
 
Nucleotide Sequence: 510 bp     [Download]
>gi|152983466|ref|NC_009656.1|:174464-174973 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGCCGAGCTGACCCTCCAGGAGCGCCTGCAGCCGTCGCTGCTCGACCGCCTCACCGACGACGAACCGG
GCAACCTGAAGGAAGCCGCGGAGCGCCGCGTGCTGACCCTGAGCCAGCTGAAGGCCTCGGTGCTGCGCGA
CCTGGCGTGGCTGTTCAACACCACCTCGCTGTTCGACCACGACCTGGCGGCGCGCATGCCGGCCGGCAAC
TCGGTGCTCAACTACGGGCTGCCGGCGCTGGCCGGGCACACCGCGTCGAGCGTCGACGTGCATGCCATCG
AGGCGTTGCTCACCGAGACCATCGCCACCTTCGAGCCGCGCATCATCCGTTCTTCGCTGCGAGTGCGCGC
GCAACTGCTGCCCGGAGAGATGGACCACAACGCCCTGAGCTTCGAGATCGAGGGCGATCTCTGGGCCGAG
CCAGCGCCGCTGCGCCTGCTGCTGACCACCAACCTGGACCTGGAGACCGGCCACGTGCGGGTCGCCCAGG
GCGAGCGGAGGCGTGCATGA
 Primer design