SecReT6
Protein ID: 152984264
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0154
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]169807..170838 [+]
Producthypothetical protein
NoteTssA
UniProt IDA6UXL5
KEGG IDpap:PSPA7_0154
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.70E-18, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 3.70E-18, Aligned region: 156..168
Protein Sequence: 343 a.a.     [Download]
>gi|152984264|ref|YP_001345550.1| hypothetical protein PSPA7_0154 [Pseudomonas aeruginosa PA7]
MLDVPVLLAAVAPDSPCGEDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRALACELFGRSKD
LRVANLLLQSNVALDGLDGLAEGLLLVRELLDQYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVW
AIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGAFADADADALAATRRALEGAQEHALAIEGGV
AERVGSAQGLDLAPLRQLLRQALQVFDLYGPQGAGASVVPGAEAAPAEEPGAAPVAAAVPAARASGEIGN
REDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGITQFETLRGPENE
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|152983466|ref|NC_009656.1|:169807-170838 Pseudomonas aeruginosa PA7 chromosome, complete genome
GTGCTGGATGTACCCGTTTTGCTGGCCGCCGTAGCCCCGGACTCGCCCTGTGGCGAGGACCTGGAGTACG
ACGCCGCCTTCCTCGAGCTCGAACGCATCGCCCAGGGCCAGCCCGAGCGGCAGATGGGCGACGCCGTGTT
GCCCGCCGAACCGCCGGAGTGGCCGCGCGTGCGCGCGCTGGCCTGCGAGCTGTTCGGCCGCAGCAAGGAC
CTGCGGGTGGCCAACCTGCTGCTGCAGAGCAATGTCGCCCTCGACGGCCTGGACGGGCTCGCCGAGGGCC
TGTTGCTGGTCCGCGAACTGCTCGACCAGTACTGGGACGGGGTCTATCCGCTGCTCGACGCCGATGACGA
CAACGACCCCACCTTCCGCATCAACGCCCTCACCGGCCTGGTCGCCGAGCCGCTGCTGCAACTGGTCTGG
GCGATCCCGCTGGTGCGCTCGCGGGCGTTCGGCCCGGTCAACCTGCGCGCCGCGCTGAACGCCGCCGGCC
TGCAACGCTTCGCCAGCGAGACCCTGAGCCCCGAGCAGATCGCCGGCGCCTTCGCCGATGCCGACGCCGA
TGCGCTGGCCGCCACCCGGCGCGCCCTGGAAGGCGCCCAGGAACATGCCCTGGCCATCGAGGGCGGTGTC
GCCGAACGGGTCGGCTCGGCCCAGGGCCTCGACCTCGCCCCCCTTCGCCAACTGCTTCGCCAGGCCCTCC
AGGTGTTCGACCTGTACGGCCCGCAGGGCGCCGGCGCATCCGTCGTGCCGGGCGCCGAAGCGGCCCCCGC
CGAAGAGCCCGGCGCAGCGCCTGTCGCCGCCGCCGTGCCGGCAGCGCGCGCCAGCGGCGAGATCGGCAAC
CGCGAGGATGTCCTGCGCCAGCTCGACCGCCTGCTCGAGTATTACGTTCGCCACGAGCCATCGAGCCCGG
TGCCGGTGCTGCTCAAGCGCGCCAAGACGCTGGTGACGGCGGACTTCGCCGAAATCGTGAGAAATCTCAT
CCCCGATGGGATCACTCAGTTCGAAACCCTGCGGGGCCCGGAGAACGAGTAA
 Primer design