SecReT6
Protein ID: 152984454
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0148
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]161170..164700 [-]
Producthypothetical protein
NoteTssM
UniProt IDA6UXK9
KEGG IDpap:PSPA7_0148
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.60E-98, Aligned region: 86..127
ImcF-related_N [PF14331], Evalue: 7.60E-98, Aligned region: 192..455
IcmF-related [PF06761], Evalue: 2.80E-92, Aligned region: 503..799
DUF1215 [PF06744], Evalue: 1.30E-40, Aligned region: 71..105
DUF1215 [PF06744], Evalue: 1.30E-40, Aligned region: 694..726
DUF1215 [PF06744], Evalue: 1.30E-40, Aligned region: 815..852
DUF1215 [PF06744], Evalue: 1.30E-40, Aligned region: 914..1035
AAA_10 [PF12846], Evalue: 0.0012, Aligned region: 130..287
AAA_10 [PF12846], Evalue: 0.0012, Aligned region: 598..683
AAA_16 [PF13191], Evalue: 0.0062, Aligned region: 127..255
AAA_16 [PF13191], Evalue: 0.0062, Aligned region: 609..645
AAA_16 [PF13191], Evalue: 0.0062, Aligned region: 777..845
AAA_19 [PF13245], Evalue: 0.0081, Aligned region: 129..145
AAA_19 [PF13245], Evalue: 0.0081, Aligned region: 495..531
Protein Sequence: 1176 a.a.     [Download]
>gi|152984454|ref|YP_001345544.1| hypothetical protein PSPA7_0148 [Pseudomonas aeruginosa PA7]
MKGFLNFFTRWVVPVLGLLALSLVIWFLGPLLRLGNYEPLASATSRWVLIALLFLVWIGFRVLRIVQARR
NAAKVMQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKT
TALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKT
QRKRRPIDGAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDS
LNREERAQVWGMTFALDDGKSAEGPLAGFASEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAAL
RECLGEFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIER
LFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGI
ESLSPAQRDVLAVLPQLNAVQNLANDAPGWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQL
RSGGSSDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSAR
LDQDLVEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTY
RGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVT
QAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGVREQP
QQADSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNTLYVQVSAMAGASGDSLLGDAKNQVAAAASR
VALSAERQPPVVQGLVKKVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDF
GHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPTVR
FELKPVTMDAAISQFILDLDGQQLTYDHGPSRPVAMQWPSANGLGVVRLTVTPAPSSGRSGLTLEGPWAW
FRLLDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c164700-161170 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAAAGGCTTCCTCAACTTCTTCACGCGCTGGGTGGTGCCGGTGCTCGGCCTGCTCGCTCTGAGCCTGG
TCATCTGGTTCCTCGGCCCGCTGCTGCGCCTGGGCAACTACGAGCCGCTGGCCTCGGCGACCAGCCGCTG
GGTGCTGATCGCCCTGCTGTTCCTGGTCTGGATCGGCTTCCGCGTGCTGCGCATCGTGCAGGCCCGGCGC
AACGCGGCGAAGGTCATGCAGAGTCTCGCCGAGGTCAGCGCGCCGGACGCCGCCAGCGTCGCCACCGCCG
AAGAGCTGGCGACCCTCAAGCAACGCATGGACGAGGCCCTGGCCCTGCTCAAGCGGGCCAAGCTGGGCGG
CAGCGAGCGGCGCAACCTGTACGAGCTGCCCTGGTACGTGATCATCGGCCCGCCCGGTTCGGGCAAGACC
ACCGCGCTGATGAACTCCGGCCTGGACTTCCCGCTCGCCGCGCAGATGGGCGCCGGGGCGATCCGCGGGG
TCGGCGGCACGCGCAACTGCGACTGGTGGTTCACCGACGAAGCGGTGCTGCTGGACACCGCCGGCCGCTA
TACCACCCAGGACAGCCACGCCCAGGTGGACAAGGCCGCCTGGCTGGGCTTCCTCGACCTGCTCAAGACC
CAGCGCAAGCGCCGTCCCATCGATGGCGCGTTCATCGCCATCAGCCTCTCCGACCTGCTGCTGGGCAGCG
ACGCCGAGCGCGCCGCCCACGCCCAGGCGATCCGCGCGCGGATCCAGGAGCTGTACCAGCAGCTCGGCGT
GCGCTTCCCGATCTACGTGATGCTGACCAAGTTCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAGC
CTGAACCGCGAGGAGCGCGCCCAGGTCTGGGGAATGACCTTCGCCCTCGACGACGGCAAGAGCGCGGAAG
GCCCGCTGGCGGGTTTCGCCAGCGAGTTCGCGCTGCTCGAGCAGCGCCTCACCGCGCGCCTGGTCGAGCG
CCTGCAGCAGGAACGCGACCCGGCGCGGCGCGACCTGGTCTACGGCTTCCCGCAGCAGTTCGCCGCCCTG
CGCGAGTGCCTCGGCGAGTTCCTCAATGGCGTGTTCAAGCCCAACCCCTACGAGGAACGCCCGCTGTTGC
GCGGCCTGTACTTCACCAGCGGAACCCAGGAAGGCAGCCCGATCGACCGCCTGATCGGCAGCATGGCGCA
GTCGATGAACCTCGACCGCCAGCACCTGGCGCGGCAGACCGGCACCGGGCGCAGCTACTTCATCGAGCGG
CTGTTCCGCGAAGTGGCGTTCGGCGAGCGCGGGCTGGTCGGCACCAACCCGAAGGTCGAGCGCCGCCGCA
AGTGGCTGACCATCGGCGCGCTGAGCGCCACCGCGCTGGTGGTGCTGGCGGTGACGGCGGTATGGATCGC
CAGCTACCGCGCCAACCAGAGCTACATCGCCGCGGTCGACCAGCGCGTCGACCCGCTGGCGCGCGGCATC
GAGTCGCTGAGTCCGGCGCAGCGCGACGTGCTCGCCGTGCTGCCGCAGCTCAACGCGGTGCAGAACCTCG
CCAACGACGCGCCGGGCTGGGCCGAAGGCTACGGGCTGTACCAGGGCGACATGCTCGGCGAGGAGTCCGC
CAGCGTCTACCGCAAGCTGCTGATCGCGGTGTTCGCCCCGCGCCTGGTGACCCGCATCGAGGAACAGCTG
CGCTCCGGCGGCAGCAGCGACTTCCTCTACGAGGGCCTGAAGGCCTACCTGATGCTCGGTAGCCCCGACC
ACTACGACGCCGACTTCATCAAGGCCTGGATCAGCCTCGACTGGGAACGCAACCTGCCGCGCGACCTCTC
GCCGGAACAGCGCCAGGCGCTGCACGCGCACCTCGACGCGTTGCTCGAGCGGCGGCCGCCGTCGGCGCGC
CTGGACCAGGACCTGGTCGAGGACCTGCGCCGCCAGTTGCAGCAACTGCCGGTGGCGCAGCGGGTCTACG
ACCGGGTCAAGCGGCAGAGGCTGCCCAAGGACGTGCCCGACTTCCGCATCAGCGACGCCGCCGGCCGCGA
CGCGCCGCTGGTGTTCGCGCGCAAGAGCGGCAAGCCGCTCACCGACCCGCTCAGCGGCTTCTTCACCTAC
CGCGGCTACCGCGAGGTGTTCCTCACCGCCAGCCTCAGCCAGGCCGGCACCATCGCCGAGGAACAGTGGG
TGCTCGGGCGCGACCTGAACGATGCCGGCGACGCCGCCAACCTGGCCCTCGACGTGCGTCGCCTGTACTT
CCAGGACTACCTGCGGCAGTGGGACGACCTGCTCGCCGACCTCACCGTGGTGCCGATCACCAACGTCACC
CAGGCCGCCGACGTGCTGCGCATCCTTTCCGGACCGACCTCGCCGTTCCGCAAGCTGCTCGAGGCGGTGG
CCCGCGAGACCGACCTGCAGAAAGGCGACCGGCTGGTCGCCGCGCAGGTGAAGAAGGCCGCCGACGGCAC
CGTGGACAAGCTCAAGCAGCGCCTCGGCTCGCTGGTCGGCCAGGAAGAGGAGGGCGTCCGCGAACAGCCG
CAACAGGCCGACAGCGACCCGATCAGCGCGCACTTCGCCGAACTCAACAGCCTGGTCAGCAAGGGCGAGG
GCGGCAACGAGCCAGCGCCGATCGACAGCCTGCTGGAGGACATGAACACCCTCTACGTACAGGTCAGCGC
CATGGCCGGAGCCAGCGGCGACTCGCTGCTCGGCGACGCCAAGAACCAGGTGGCCGCCGCCGCCTCGCGC
GTGGCCCTGAGCGCCGAGCGCCAGCCGCCGGTGGTCCAGGGCCTGGTGAAGAAGGTGGTCAACTCCACCA
CCAGCAGCATGATGGGCAGCGTGCGCAACCAGCTCAACGCGGCGTGGATCAGCGACGTGGTCAGCGTCTA
CCGGCAATCCCTGGCCGGGCGCTACCCGATCGCCGCCGGCAGCTCGCGCGACGCCACCCTGGAGGACTTC
GGCCACTTCTTCGGGGCCGGCGGGGTGATGGACAGCTACTTCCGCCAGTACCTGCAACCCTACGTCGACA
CCTCCGCCAGCACCTGGCGCTGGCAGCCCGGCGCGGCGCAGAAGCTCGGCATCAACCCCGGCGTGCTGCA
CACCTTCCAGCGCGCGGCGGCGATCCGCGACGCCTTCTTCCGCTCCGGCGGCATGCAACCGACGGTGCGC
TTCGAGCTCAAGCCGGTGACCATGGACGCGGCGATCAGCCAGTTCATCCTCGACCTCGACGGCCAGCAAC
TGACCTACGACCACGGCCCGAGCCGCCCGGTGGCGATGCAGTGGCCGAGCGCCAACGGCCTCGGCGTGGT
CCGCCTGACCGTGACGCCGGCGCCCAGCAGCGGCCGCTCCGGGCTGACCCTGGAAGGCCCCTGGGCCTGG
TTCCGCCTGCTCGACCAGTCGGACCTGGAGCGCGGCAACTCGCCGGACCGCTTCACCCTGCGGCTGCGCA
TCGACGGCTCCAGCATCGCCTGCGAACTGCGCGCCAGCAGCGCCTTCAACCCCTTCAAGAGCCGGGTCGT
GTCCGGTTTCAGCCTCCCGGAGCGCCTTTGA
 Primer design