SecReT6
Protein ID: 152984677
SecReT6 ID219
T6SS typei1
Gene symbolstk1
Locus tagPSPA7_3601
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3725944..3726933 [-]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDA6V7C0
KEGG IDpap:PSPA7_3601
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 1.30E-39, Aligned region: 51..286
Pkinase_Tyr [PF07714], Evalue: 1.80E-24, Aligned region: 53..306
APH [PF01636], Evalue: 1.50E-05, Aligned region: 97..149
APH [PF01636], Evalue: 1.50E-05, Aligned region: 164..203
APH [PF01636], Evalue: 1.50E-05, Aligned region: 229..305
RIO1 [PF01163], Evalue: 0.0018, Aligned region: 128..202
APH_6_hur [PF04655], Evalue: 0.0091, Aligned region: 162..194
Protein Sequence: 329 a.a.     [Download]
>gi|152984677|ref|YP_001348955.1| serine-threonine kinase Stk1 [Pseudomonas aeruginosa PA7]
MNEPLSSLELLPEEEGGANLTYFAFAAPAASAPELPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPSVVRLFTFDVDTACQRAYIVMELMS
GLPLDRLLCERPEGLPWSELSAIARPLLDALAYAHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVFAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3726933-3725944 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCAAACCTGACCTATTTCG
CCTTCGCCGCCCCGGCCGCCTCGGCGCCGGAGCTGCCGGCCGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGGCGCTACCGTCTGGAGCGGATGCTGGGCGCCGGCGGCATGGGGACGGTATACCGTGCCCGGGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCGCTGGTAGCGCTGAAGCTGCTCAACGAATCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAGCGT
CGTGCGTCTGTTCACTTTCGACGTCGACACCGCCTGCCAGCGCGCCTACATCGTCATGGAACTCATGTCT
GGCCTGCCGCTCGACCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGCTGAGCGCGATCG
CCCGGCCGTTGCTGGATGCTCTGGCCTATGCCCACGAACAAGGGGTGCTGCATGGCGACCTGAAGCCGAG
CAACGTGATGCTCGGCGAGGAGGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGACGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACTCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGCGCGCCGCTGTCGCCGGCGGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGACGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGTTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAGCCTCGACCCCGAAC
GACGCTGCATCGGCGTCCGCGAATTGCAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTTT
CGCCCGTTGA
 Primer design