SecReT6
Protein ID: 152984686
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0145
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]156649..159747 [-]
Productserine/threonine protein kinase PpkA
NotePpkA
UniProt IDA6UXK6
KEGG IDpap:PSPA7_0145
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 2.50E-52, Aligned region: 9..249
Pkinase_Tyr [PF07714], Evalue: 3.90E-35, Aligned region: 10..248
VWA_2 [PF13519], Evalue: 2.50E-13, Aligned region: 113..148
VWA_2 [PF13519], Evalue: 2.50E-13, Aligned region: 616..791
APH [PF01636], Evalue: 1.60E-05, Aligned region: 12..120
APH [PF01636], Evalue: 1.60E-05, Aligned region: 112..150
APH [PF01636], Evalue: 1.60E-05, Aligned region: 214..264
Kinase-like [PF14531], Evalue: 0.0002, Aligned region: 119..211
VWA [PF00092], Evalue: 0.00052, Aligned region: 616..772
Kdo [PF06293], Evalue: 0.0038, Aligned region: 101..149
Protein Sequence: 1032 a.a.     [Download]
>gi|152984686|ref|YP_001345541.1| serine/threonine protein kinase PpkA [Pseudomonas aeruginosa PA7]
MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAADPSFAERFLREGRTLARLSHPNTVT
IHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPELGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRAD
GTAVLSDFGIAKSIEDNTQFTQVGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKD
SLSTALAHLTEPLPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQG
SPRATDPPPAGPAPMPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPPLPPAKPRAGG
SRTPLIAAAAAAVLLAIGGGAWWLLGSGDAPNAADPAPLGQTPTDKPPQQTPMADAEQDGGERPLLMPGK
KTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYARKQVGGSPWLRVGASSNGAGDGWLPASAVSDW
KQSLVLKFTERSGRAPVMFLNSAEQVERLLGDTRAARDTLTQAVDHEGDPQVVAVEPNDRAIPQDQFYLL
PIFDSKESFDADGQPAQLLEVASIDPGGSAAAPQAPGQAGQGGASGAASDTFRTGIVLVVDTSVSMQPYI
DRVREVIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSSQVRATD
VSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNEAEVRQAALRKGVKIYAL
HLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAP
RFDAAPSVASKSAAIGYAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQS
LKLIVDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWL
SLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP
 
Nucleotide Sequence: 3099 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c159747-156649 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGACATAGAACTTCCGGGTTTCGACATCGAACGCGAACTGGGCGAAGGCGCCATGGCCACGGTCTACC
TGGCCACCCAGCGCTCGCTGCAACGCAAGGTGGCGCTCAAGGTCATGGCCGCGGCGCTGGCCGCCGACCC
GAGCTTCGCCGAACGCTTCCTGCGCGAAGGTCGGACCCTGGCGCGGCTGTCGCACCCGAACACGGTGACC
ATCCACGACATCGGCAACGTCGGCAGCTGCTACTACATGGCCATGGAGTACCTGCCCAACGGCACGCTCA
AGGAGCGTATCCAGCAGGGCCTCGATCCTGAGCTGGGCCTGGCCTACGTGCGGCAGGTGGCCGCCGCGCT
CGGCTACGCGCACTCCCAGGGCCTGGTGCATCGCGACGTGAAGCCGGCCAACATCCTGTTCCGCGCCGAC
GGCACCGCGGTGCTCTCGGACTTCGGCATCGCCAAGTCGATCGAGGACAATACCCAGTTCACCCAGGTCG
GCTTCGCCGTCGGCACCCCCAGCTACATGAGCCCGGAGCAGGCCCGTGGCCAGGAGATCGACGGCCGCGC
CGACCTCTACGCGCTGGGCGTGGTGCTCTACGAGATCCTCACCGGCAAGCTGCCCTACAACGGCAAGGAT
TCGCTCTCCACCGCCCTGGCCCACCTCACCGAGCCGCTGCCGGAACTGCCGATCGAGCAGGGCCGCTACC
AGGACATCCTGCGCCAGTTGCTGGCCAAGGACCCGGCCGAGCGCTTCCCCACCGCCGGCGCGCTGATCGC
CGCCCTCGACCGCCTGGCGCCGAGCGCCCTGGAAGCCACCCAGATCCGTCCGCTGGCGACGCCGCAGGGC
TCGCCGCGAGCGACCGACCCGCCGCCGGCCGGGCCCGCGCCCATGCCGCCCGCCGACCTCGGCGGCCTGC
AACCGGTGTCGATCCAGTTGCCGCCGGTCACGCCCAGCGCCGGCGGCGCCACGCCGCCTCCACCTCCGCC
GTCGCAAGCGGCGAAACCGCCATCGCCCCCGCCGCCTCCGTTGCCGCCGGCGAAGCCACGTGCCGGCGGC
AGCCGCACGCCGCTGATCGCCGCCGCCGCGGCCGCCGTGCTCCTGGCGATCGGCGGCGGCGCCTGGTGGC
TGCTGGGCTCGGGCGACGCGCCGAACGCTGCCGATCCAGCGCCGCTGGGACAGACGCCGACGGACAAGCC
GCCGCAGCAGACTCCGATGGCCGACGCCGAACAGGACGGCGGCGAGCGTCCGCTGCTGATGCCGGGCAAG
AAGACCCTGTTCCAGCGCGTCCTGACCAAGCCCGGCGCGGCCATCTCCGCCGAGGCTGGCGGCCCGCCCC
GGGCCGGCGCGGTGCCGGCCTTCTCGGTGCTCTACGTGTACGCCCGCAAGCAGGTCGGCGGCAGCCCCTG
GCTGCGCGTCGGCGCCTCGAGCAACGGCGCGGGCGACGGCTGGCTGCCGGCCAGCGCGGTGAGCGACTGG
AAGCAGAGCCTGGTGCTGAAGTTCACCGAACGCTCCGGCCGCGCGCCGGTGATGTTCCTCAACAGCGCCG
AGCAGGTCGAGCGCCTGCTCGGCGATACCCGCGCGGCGCGCGACACCCTGACCCAGGCGGTGGACCACGA
GGGCGATCCGCAGGTGGTCGCGGTCGAGCCCAACGACCGGGCGATCCCCCAGGACCAGTTCTACCTGCTG
CCGATCTTCGATTCGAAGGAGAGCTTCGACGCCGACGGCCAGCCGGCGCAGTTGCTGGAGGTCGCCTCGA
TCGACCCCGGCGGCAGCGCCGCGGCACCCCAGGCGCCGGGCCAGGCCGGGCAGGGCGGCGCCAGCGGCGC
GGCGAGCGACACCTTCCGCACCGGCATCGTCCTGGTGGTGGACACCTCGGTGTCGATGCAGCCCTACATC
GACCGCGTGCGCGAGGTGATCGATGGCCTGCAGCGGCAGATCGGCGAGCGCGGCGACCTGGACAAGGTCA
GCTTCGGCCTGGTCGGCTTCCGCAACAACACCGACAAGACCCCCGGCCTGGAATACGTCAGCAAGACCCT
GGTGCCGCTGCAACCGGGCAACGACGCACAGCGCTTCGCCGAGCTGAGCAGCCAGGTGCGCGCCACCGAC
GTCTCCAGCCACTCGTTCAACGAGGACGCCTTCGCCGGGATCATGCAGGCGGTCGACGAAATGGACTGGT
CGCCCTATGCCGGGCGCGTGGTGCTGCTGGTCACCGACGCCGGCGCGCTGCGCAAGAACGACCCCCTCGG
GCGCACCCAGATGAACGAGGCCGAGGTCCGCCAGGCGGCGCTGCGCAAGGGCGTGAAGATCTATGCCCTG
CACCTGCGCACCCCGGCCGGGAAGAACAACCACGGCTACGCCGAGCAGCAGTACCGCAGCCTCACCGCCG
ACGCCAACCCGAAGATCGCCGACCTCTACATCCCGGTGGCCGGCGGTGAGGTGAACGCCTTCGGCAACAC
GGTGAAGGAGATCGGCACGGTGTTCGCCGACCTGGTCCACGACGCCGGCAACCGCAAGCCGCAGGCGCCG
CGCTTCGACGCCGCGCCGAGCGTGGCGAGCAAGTCGGCGGCCATCGGCTACGCCATGCAGATGGAATTCC
TCGGCCGCCGCGACCCGGTGCGCGCGCCGCAGGTCGTCACCGCCTGGACCGCCGACCGCGACCTGACCAA
CCCGGCGCTGCCGGCGTTCCAGGTCTGCGTGCTGCTGAGCAAGCTGCAACTCAACGAATTGCAACAGTCG
CTGAAACTGATCGTCGACGCGGCCAAGCGCACCCAGACCTCGCCCAAGGACTTCTTCCAGGAGATCGCCA
GCGCCAGCGCCTACATGAGCCGCGACCCGGCGCAGCTGGTGAAGGGCAGCAACCTGGCGCAGAGCGGCGT
GCTCGGCGAATACCTGGAAGGCCTGCCGTACCGCAGCAAGTCGCTGAACATGACCCAGGACCTCTGGTTG
TCGCTGAGCGTCGCCGAGCAGCAGGACTTCATCGACGAGCTGGAGTCGAAGATCCGCCTCTACGAAACCT
TCCACAACGACGTCGCCAACTGGGTCCGGTTCGGCGACGCCGACGCCGGCGACGCGCTGTACCGCGTGCC
GCTGTCGACCCTGCCATGA
 Primer design