SecReT6
Protein ID: 152985140
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0151
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]167404..167868 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDA6UXL2
KEGG IDpap:PSPA7_0151
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-42, Aligned region: 11..146
Protein Sequence: 154 a.a.     [Download]
>gi|152985140|ref|YP_001345547.1| putative lipoprotein [Pseudomonas aeruginosa PA7]
MQKLMIALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFAL
TDNAPSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDIPGQRTSHLDVT
LGAQAIGIVARPAP
 
Nucleotide Sequence: 465 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c167868-167404 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCAGAAACTGATGATCGCGCTGTTCGGGCTGCTGCTCGCCGCCTGCTCGTCCAGCCCGCCGGAAACCC
CGCCGACGCGGGTGGTGATCTGGCTCCACGCCGCGCCCAACCTCAACCCGTCCGCCGCCGGCCAGGCGGC
GCCGCTGCGCCTGCGGCTGTACGAGCTGAAGAAGGACACCGCGTTCGGCCGCGCCGACTACTTCGCTCTC
ACCGACAACGCGCCGTCCACGCTCGGCGGCGACCTGGTGGAGCAGGACGAGTTCCTCCTGCGTCCGGGCG
AGGAGCGGCGCATCGAGCGCACCCTCGACGAGCAGACCCGCCAGCTCGGCTTCGTCGCCGCCTACCGCGA
CCTCGACCGCGCCACCTGGCGCCAGGTCCTGGACATCCCGGGGCAACGCACCAGCCATCTCGACGTCACG
CTCGGCGCGCAGGCCATCGGCATCGTCGCGCGTCCCGCGCCCTGA
 Primer design