SecReT6
Protein ID: 152985159
SecReT6 ID219
T6SS typei1
Gene symbolstp1
Locus tagPSPA7_3602
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3726930..3727658 [-]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDA6V7C1
KEGG IDpap:PSPA7_3602
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.10E-16, Aligned region: 19..204
PP2C [PF00481], Evalue: 3.50E-16, Aligned region: 31..234
SpoIIE [PF07228], Evalue: 5.70E-11, Aligned region: 35..241
Protein Sequence: 242 a.a.     [Download]
>gi|152985159|ref|YP_001348956.1| serine/threonine phosphoprotein phosphatase Stp1 [Pseudomonas aeruginosa PA7]
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAELPARAGFDER
LNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVGDSRCYLWRGQRLYQLSRDHS
LLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVLELEVHPGDVFLLCSDGLYEELSADALGRAL
SLASPQVAVERLFDGALSGAARDNLTAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3727658-3726930 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCAACGCACCGAGCCCTGGCGCAGCGCGGCGCGCACGGATCGCGGCAAGGTCCGCGCGCGCAACGAGG
ATGCCTTCCTGGACTGCCCGGATCGCGGGCTCTGGGCGGTCGCCGATGGCATGGGCGGGCACCAGGCCGG
CGACCTGGCCAGCCGGATGATCGTCACCAGCCTGGCGGAACTGCCGGCCCGAGCGGGATTCGACGAGCGC
CTGAACGCGATGCGCCAGTGCCTGCACTGGCTCAACCGGCGCCTGGGCGAGGAACTCACCCTCAGCGCCG
AACGCGGTGACAGGATCATCGGTAGTACGGTGGTGGCGCTGGTCGTGGAGGGTTCGCGGGCGGCCTGCGT
GTGGGTTGGCGACAGCCGCTGCTACCTGTGGCGCGGCCAGCGGTTGTACCAGTTGTCCCGCGACCACTCG
CTGTTGCAGCGACTGGTCGACGAACGGCGGATGGATATCGAGCAGGCCCGCGCCTATCCCTCGGCGCGCG
CGCTGACCCGTGCCGTCGGCGCCAGCGAACAACTGGTGCTGGACGTGCTGGAACTGGAGGTGCATCCCGG
TGACGTCTTCCTGCTCTGCAGCGACGGACTCTATGAAGAGCTGAGCGCCGATGCACTGGGCCGCGCGTTG
AGCCTGGCATCGCCGCAGGTGGCGGTGGAGCGGCTGTTCGACGGCGCCTTGAGCGGCGCCGCGCGGGACA
ACCTGACGGCCGTGGTGATCCGCCAATGA
 Primer design