SecReT6
Protein ID: 152985576
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3603
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3727658..3731185 [-]
Producthypothetical protein
NoteTssM
UniProt IDA6V7C2
KEGG IDpap:PSPA7_3603
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.50E-76, Aligned region: 255..273
IcmF-related [PF06761], Evalue: 1.50E-76, Aligned region: 502..792
IcmF-related [PF06761], Evalue: 1.50E-76, Aligned region: 948..996
ImcF-related_N [PF14331], Evalue: 6.80E-75, Aligned region: 196..453
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 910..1031
Protein Sequence: 1175 a.a.     [Download]
>gi|152985576|ref|YP_001348957.1| hypothetical protein PSPA7_3603 [Pseudomonas aeruginosa PA7]
MKNFFKKVGVFLRKTWVWTLLLVLLAALLVWFVGPLLAVADYKFWESPTSRLLSISLMFLVWGLAMVFVS
WRAGVRRKAVEDSDEGQERLRRDGLIEDEQKELRSRFKDALRTLKTSSLYRGRSERWRNELPWYLLIGPQ
GSGKTSLLDFSGLEFPINRIDRKLTRDTAGTRYCDWYFADHGVLIDTAGRYLTQADGEVDGGAWATLLGL
LRKRRRARPLNGVMVSIPVETLLSDDEMALDTLARQVRARLQEIQQTLHLDLPVYLVLSKADQLLGFDEF
FDQLSREESDQVLGTSFGKEQNGTDVTVLRQAFEDLLRRLNSQVIMRIHQERDTLRRGRILDFPHQLGQI
GERLCLFVELAFTGNRYQRASRLRGFYLTSAPHLAQQLDEDTAGIGANLGIASGLLPTLRNGRSRFIHHL
LSQVIFPEANLAGLDRRERTRIHWGQRALYVGSLALLMLFGLLWAGGFSANHERLERVRELAQQWTQQRQ
ALGERDDAMAALKTLDSSYAATTVFPPKGEVSLHERAGLYQGNEVNPPLAAAYRRELETQLLPRVARMLE
AQIRGNLQNRERLLNSLRAYLMLNLRERRENGWLKDWVATDWSQRYAGNGTVQNGLNTHFARLLEQPFSY
PLNDTLVAQARQVLRSESLANVVYRVLREQARSLPEYRFGQHLGPQAGLFVGTDYVIPGFYTQQGYQQYF
VVQGASLVNDILRDNWVLGEGSGISDMDLRRLMVELEQLYFRDYANFWSEAVGRLGLLPFNDAGEGADQI
SGLLAANSPILQLLLEVRENTRFPVLAESAEALAEASDKATEKGGKLGKAAAAAAGKARDALAKNLPDTA
KKSLQRRFEPLHRLLDDNNGPAADLTPLLQALNELQLQLAGLARASQPEQAAFDMAKSRMGGQRDALSNL
RNASARLPRPLGGWFSVLAEDAWRLVLGDAYLYLNQRYQSELYGFYSKAINKRYPFNAHSASDVAVSDFR
EFFKAQGVAERFFETYMRPFVSGDPGSYRLRSVDGYSLPMSKVYLDQMGTALVIRQSFFAENPAEPQVRF
RLEPYTLDPGVSRAEFRFDGQSMEYRHGPIVPMSFKWPSDADGGRTSLVLERMAGRPVGVERNTGPWSLF
RLFDLMQTEYLSGRDVMVLKADLGGLRANYLLLAQRTPNPFDLAVLRSFRMPVQL
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3731185-3727658 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAAAAACTTCTTCAAGAAAGTCGGCGTCTTCCTGCGCAAGACGTGGGTCTGGACGCTGTTGCTGGTAC
TCCTGGCGGCATTGCTGGTGTGGTTCGTCGGGCCGCTGCTGGCGGTCGCCGACTACAAGTTCTGGGAAAG
CCCGACCTCGCGGTTGCTGAGCATCAGCCTGATGTTCCTGGTCTGGGGGTTGGCGATGGTCTTCGTCAGC
TGGCGCGCCGGAGTGCGGCGCAAGGCCGTCGAGGACAGCGACGAGGGCCAGGAGCGCCTGCGCCGCGACG
GTCTGATCGAAGACGAACAGAAGGAATTGCGCAGCCGCTTCAAGGACGCCTTGCGCACCCTGAAGACCTC
CAGCCTGTACCGCGGCCGCAGCGAGCGCTGGCGCAACGAGCTGCCCTGGTACCTGCTGATCGGCCCGCAG
GGAAGCGGCAAGACCAGCCTGCTGGACTTTTCCGGACTGGAATTCCCGATCAACCGGATCGACCGCAAGT
TGACCCGTGACACCGCCGGTACGCGCTACTGCGACTGGTACTTCGCCGACCACGGCGTCCTGATCGACAC
CGCCGGGCGCTACCTGACCCAAGCCGACGGCGAGGTCGACGGGGGCGCCTGGGCGACCCTGCTCGGCCTG
TTGCGCAAGCGCCGCCGCGCACGGCCGCTGAATGGCGTGATGGTGTCGATTCCGGTGGAGACGTTGCTCA
GCGACGACGAGATGGCGCTGGATACGCTGGCTCGCCAGGTGCGCGCGCGTCTGCAGGAAATCCAGCAGAC
CCTGCACCTCGATCTGCCGGTCTACCTGGTGCTGAGCAAGGCCGACCAGTTGCTCGGCTTCGACGAGTTC
TTCGACCAGTTGAGCCGCGAGGAGAGCGACCAGGTTCTGGGCACCAGCTTCGGCAAGGAGCAGAACGGCA
CCGATGTGACGGTCCTGCGCCAGGCGTTCGAGGACCTCCTGCGACGCCTGAACAGCCAGGTGATCATGCG
CATCCACCAGGAACGCGATACCCTGCGTCGCGGTCGCATCCTCGACTTTCCGCACCAGCTTGGCCAGATC
GGCGAGCGGTTGTGCCTGTTCGTCGAACTCGCCTTCACCGGCAATCGATACCAGCGCGCCAGCCGCCTGC
GCGGCTTCTACCTGACCAGCGCGCCGCACCTGGCCCAGCAGCTGGACGAGGACACCGCCGGCATCGGCGC
CAACCTGGGGATCGCCAGCGGCCTGCTGCCGACCCTGCGCAACGGGCGCTCGCGCTTCATCCATCACCTG
CTGAGCCAGGTGATCTTCCCCGAGGCCAACCTGGCAGGTCTCGATCGCCGCGAACGCACGCGCATCCACT
GGGGCCAGCGCGCCCTGTACGTCGGTTCGCTGGCGCTCCTTATGCTATTCGGCCTGCTCTGGGCTGGCGG
TTTCTCGGCCAACCACGAGCGCCTGGAGCGGGTGCGCGAGCTGGCGCAGCAATGGACCCAACAGCGCCAG
GCGCTTGGCGAACGCGATGACGCCATGGCGGCGCTGAAGACGCTGGATAGCAGCTATGCGGCGACCACCG
TGTTTCCGCCCAAAGGGGAAGTCTCGCTGCACGAGCGCGCCGGGCTGTACCAGGGCAACGAGGTCAACCC
CCCGCTGGCCGCTGCCTATCGCCGCGAGCTGGAGACGCAACTGCTGCCGCGTGTGGCGCGGATGCTTGAA
GCGCAGATCCGCGGCAATCTGCAGAATCGCGAACGCCTGCTCAACAGCCTGCGGGCCTACCTGATGCTGA
ATCTGCGCGAGCGCCGCGAGAACGGATGGCTCAAGGACTGGGTGGCTACCGACTGGTCGCAGCGCTATGC
CGGCAACGGCACCGTGCAGAATGGCCTGAACACGCATTTCGCCCGTCTGCTCGAGCAACCGTTCAGCTAT
CCGCTGAACGACACCCTGGTGGCCCAGGCACGCCAGGTGCTGCGCAGCGAGTCCCTGGCCAACGTGGTCT
ACCGGGTGCTGCGCGAACAGGCGCGAAGCCTGCCCGAGTATCGCTTCGGCCAGCACCTGGGGCCGCAGGC
CGGTCTGTTCGTCGGCACCGACTACGTGATCCCGGGGTTCTATACCCAGCAGGGCTACCAGCAGTACTTC
GTGGTCCAGGGCGCCAGCCTGGTCAACGATATCCTTCGCGACAACTGGGTCCTGGGCGAGGGCAGCGGGA
TCAGCGACATGGACCTGCGGCGCCTGATGGTCGAACTCGAACAGCTGTATTTCCGCGACTACGCGAACTT
CTGGAGCGAGGCGGTCGGACGCCTGGGCCTGCTGCCGTTCAACGATGCCGGCGAGGGTGCCGACCAGATT
TCCGGGCTGCTCGCCGCCAACTCGCCGATCCTCCAGTTGTTGCTGGAGGTCCGTGAGAACACCCGTTTCC
CGGTCCTGGCGGAGAGCGCCGAGGCGCTGGCAGAGGCTAGCGACAAGGCCACGGAAAAGGGCGGCAAGCT
GGGCAAGGCGGCCGCTGCGGCGGCCGGCAAGGCCAGGGACGCGTTGGCGAAGAACCTGCCGGATACCGCG
AAGAAGTCCCTGCAACGCCGCTTCGAGCCCCTGCATCGCCTGCTCGACGATAACAACGGCCCGGCGGCCG
ACCTCACCCCGCTGTTGCAGGCGCTCAACGAGTTGCAGTTGCAACTCGCCGGACTGGCGCGCGCCAGCCA
GCCGGAGCAGGCGGCTTTCGACATGGCGAAGAGCCGCATGGGCGGCCAGCGCGATGCCCTGAGCAACCTG
CGCAACGCCTCCGCGCGACTGCCGCGACCGCTCGGCGGATGGTTCAGCGTACTGGCCGAAGACGCCTGGC
GGCTGGTCCTCGGCGATGCCTACCTGTACCTCAACCAGCGCTACCAGAGCGAGCTGTACGGTTTCTACAG
CAAGGCGATCAACAAGCGCTACCCGTTCAACGCGCACAGCGCCAGCGATGTCGCGGTCAGCGATTTTCGC
GAGTTCTTCAAGGCGCAGGGCGTCGCCGAACGCTTCTTCGAAACCTACATGCGGCCCTTCGTCAGCGGTG
ACCCGGGCAGCTACCGCCTGCGCAGCGTGGACGGCTACAGCCTGCCGATGTCCAAGGTCTATCTCGACCA
GATGGGCACGGCCCTGGTGATTCGCCAGAGCTTCTTCGCCGAGAACCCGGCCGAGCCGCAGGTGCGCTTC
CGCCTGGAGCCCTATACCCTCGATCCTGGCGTCAGCCGCGCCGAGTTCCGTTTCGACGGTCAATCCATGG
AATACCGCCACGGCCCGATCGTGCCGATGTCGTTCAAGTGGCCCAGCGACGCCGACGGCGGCCGCACCAG
CCTGGTGCTGGAGAGGATGGCCGGGCGACCGGTGGGAGTCGAACGCAATACCGGGCCCTGGTCGCTGTTC
AGGCTGTTCGACCTGATGCAGACCGAGTACCTCAGCGGGCGTGACGTGATGGTGCTCAAGGCCGACCTGG
GCGGCCTGCGCGCCAACTACCTGCTGCTCGCCCAGCGCACGCCGAATCCGTTCGATCTCGCGGTCCTGCG
CAGCTTCCGCATGCCGGTGCAGCTCTGA
 Primer design