SecReT6
Protein ID: 152985744
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0167
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]183308..184612 [-]
ProductPAAR motif-containing protein
NoteTse6 (e)
UniProt IDA6UXM8
KEGG IDpap:PSPA7_0167
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 8.80E-15, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 8.80E-15, Aligned region: 78..153
DUF4150 [PF13665], Evalue: 0.0043, Aligned region: 84..104
DUF4150 [PF13665], Evalue: 0.0043, Aligned region: 126..146
DUF4150 [PF13665], Evalue: 0.0043, Aligned region: 378..391
Protein Sequence: 434 a.a.     [Download]
>gi|152985744|ref|YP_001345563.1| PAAR motif-containing protein [Pseudomonas aeruginosa PA7]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLT
TIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVIIAEGSATVYINGKPAAR
LQSKMVCGAHIKTGSQDTFIGGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALAGFVAI
GGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKMARLGRASAAGEVRTPAYKRGRTEADILGL
AKGKRPPPSEYLKKSYIDKHLKVFKEEGGAFLFTTDDIANPNYTSFNPNKFVMAKSDLNSVVAEYKRTGD
VSVLESALGYDPGSLAGKEIYMLNLENPKVLMPTGNEGGVNSLWRPGGLTHPGGMREAVLDNVAIPHGND
VNVLMSTHDIARIQ
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c184612-183308 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGATGCGCAAGCCGCCGCCCGCCTGGGCGACGAGATCGCCCACGGCTTCGGTGTCGCCGCGATGGTCG
CCGGGGCCGTGGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACTGCCGCCACCGGCGGCCTGGC
CGCGGTGATCCTGGCCGGCTCGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACC
ACTATCTTCGAGCTGCCCGAACCCACCACCGGGGTGCTCATACGCGGCAGCTTCAATGTCTACGTGAACA
GCCGCAACGCGATGCGCGCCGGCGACGACGTCTCCGCCACCTGCAGCGGCCTGCCGCTGAACCATCCGCT
GTGGCCGTTCCCGGTGATCATCGCCGAGGGCAGCGCCACCGTGTACATCAACGGCAAGCCCGCCGCGCGC
TTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGGACACCTTCATCGGCGGCCCCA
CCGAGCGGGTGGCCTTCGTCCTCGACCTGGAGGAATGGCTGCACACCGGACTCGAGGCGCTGGGCCTGGC
GGCCCTTGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGCCGGTTTCGTCGCCATC
GGCGGGCTGATGATGGGCGGCATGGCCCTGCTCGGCGACCTTGGCGATCGCCTCGGTCCCGGTTACCGCG
ATCTGTTCCAGGGCGTGGCGGGGATGGCATTGCTGGGCTTCGGGCCGAAGATGGCCCGGCTCGGCCGGGC
CTCGGCGGCCGGCGAGGTACGCACGCCCGCCTACAAGCGCGGCAGGACCGAAGCGGATATCCTGGGCCTG
GCCAAGGGCAAGCGGCCGCCTCCCAGCGAGTACCTGAAGAAGTCCTATATCGACAAGCACCTGAAGGTGT
TCAAGGAAGAGGGCGGCGCCTTCCTTTTCACCACCGACGACATCGCCAACCCGAACTACACCTCGTTCAA
CCCGAACAAGTTCGTCATGGCCAAGTCCGACCTGAACTCCGTGGTCGCCGAGTACAAGCGCACCGGCGAC
GTCTCCGTGCTGGAGTCGGCGCTGGGGTACGATCCAGGCTCGCTGGCCGGCAAGGAGATCTACATGCTGA
ACCTGGAGAACCCGAAGGTGCTGATGCCGACCGGCAACGAGGGCGGGGTCAACTCGCTGTGGCGGCCCGG
CGGCCTCACCCACCCGGGCGGCATGCGCGAAGCGGTTCTGGACAATGTGGCGATCCCCCATGGAAACGAT
GTAAACGTACTGATGTCGACCCACGACATCGCGAGAATCCAATGA
 Primer design