SecReT6
Protein ID: 152985769
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0149
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]164697..166046 [-]
Producthypothetical protein
NoteTssL
UniProt IDA6UXL0
KEGG IDpap:PSPA7_0149
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.00E-70, Aligned region: 66..271
OmpA [PF00691], Evalue: 1.90E-15, Aligned region: 339..437
DUF883 [PF05957], Evalue: 0.0021, Aligned region: 90..139
DUF883 [PF05957], Evalue: 0.0021, Aligned region: 202..268
DUF883 [PF05957], Evalue: 0.0021, Aligned region: 336..369
DUF883 [PF05957], Evalue: 0.0021, Aligned region: 397..434
Protein Sequence: 449 a.a.     [Download]
>gi|152985769|ref|YP_001345545.1| hypothetical protein PSPA7_0149 [Pseudomonas aeruginosa PA7]
MSPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPASGPRAGDPYTPPPMASLAPLASRGDGLNPLEQ
AAGPLLAMLTRLRSTIAHPAPASLRAQLLGYLRQFEEKARQAGVAADEVMLARYVLCTALDEAVLSTPWG
SASDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLETL
RERTAAVIRSTRGEYERELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFR
RIHAIGEIPVQAIDRPAIQPRVIERPRLARFLAEDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDE
FQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGEAGRFTAEGRSD
TEPVATNASAEGRARNRRVEITVFAEGAQ
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c166046-164697 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGTCCCCCATCGACGATCCCTTCGGCACCCCGGCCGGCGGTGGCAACGGAAGCCCGCCCGACGACCGCA
CCATGATCATGCCGCGCCCCGGCGGTCGCGCGCCGGAACCGGCCAGCGGCCCCCGCGCCGGCGACCCCTA
CACGCCGCCGCCGATGGCCAGCCTGGCACCGCTGGCCAGCCGGGGCGACGGCCTCAACCCGCTGGAGCAG
GCCGCCGGCCCGCTGCTGGCGATGCTCACCCGCCTGCGCAGCACCATCGCCCACCCGGCGCCGGCCAGCC
TGCGCGCACAGCTGCTCGGCTACCTGCGCCAGTTCGAGGAGAAGGCGCGCCAGGCCGGGGTCGCCGCGGA
CGAAGTGATGCTGGCGCGCTACGTGCTCTGCACCGCCCTCGACGAAGCGGTGCTCAGCACGCCCTGGGGC
AGCGCCAGCGACTGGGGCAAGCAGAGCCTGTTGATCACCCTGCACAACGAGGCCTGGGGCGGCGAGAAGG
TCTTCCAGCTGCTCGAGCACTGCCTGCAGAACCCGCACCAGCGCCTGCATCTGCTGGAGCTGCTGTACCT
GTGCACCAGCCTCGGCTTCGAAGGCCGCTACCGGGTCATGCACGACGGCCGCAGCCAGCTGGAGACACTG
CGCGAGCGCACCGCGGCGGTGATCCGCAGCACCCGCGGCGAATACGAGCGCGAGCTGTCGCCGCACTGGC
GCGGCCTCAGCGTGATGCGCGACCGCCTTTCGCAATACCTGCCGCCGTGGGTCGGCATCGCCATCGGCCT
GGCCCTGCTGCTGGCCCTGCTGTTCGGCCTGCGGATGAAGCTGGCCGCCGACGCCGAGCCGGTGTTCAGG
CGCATCCACGCCATCGGCGAGATCCCGGTACAGGCCATCGACCGCCCGGCGATCCAGCCGCGGGTGATCG
AGCGGCCGCGCCTGGCGCGCTTCCTCGCCGAGGACATCAAGGCCCAGCGGGTGGCGGTGGAAGACGCCGT
CGATCGCTCGGTGGTGACCATCCGCGGCGACGAGCTGTTCGCCAGCGCCAGCGCCAGCGTGCGCGACGAG
TTCCAGCCGCTGCTGCTGCGCATCGCCGACGCCCTGCGCAAGGTCAAGGGCCAGGTGCTGGTCACCGGCC
ATAGCGACAACCGGCCGATCGCCACGCTGCGCTACCCGTCCAACTGGAAACTGTCCCAGGCCCGCGCCCA
GGAGGTCGCCGACCTGCTCGGCGCGACCACCGGCGAAGCCGGCCGCTTCACCGCCGAAGGGCGCAGCGAC
ACCGAGCCGGTGGCGACCAATGCCAGCGCCGAAGGCCGCGCACGCAACCGCCGGGTGGAAATCACCGTAT
TCGCGGAGGGTGCGCAATGA
 Primer design