SecReT6
Protein ID: 152985795
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0152
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]167913..169439 [-]
Producthypothetical protein
NoteFha
UniProt IDA6UXL3
KEGG IDpap:PSPA7_0152
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-15, Aligned region: 29..97
Protein Sequence: 508 a.a.     [Download]
>gi|152985795|ref|YP_001345548.1| hypothetical protein PSPA7_0152 [Pseudomonas aeruginosa PA7]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQNAATAPAF
PEPAATPHPAVAAHFQGGSPLDTRPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPAITPAPA
PAGGAPLIPADWDPFAELLGNTPAAGPAPATEPLATPLPTPEPAPLAMPFADPGITQQPPQPQPQPQPQP
QPQPQPQPQPQPQPQPASVAPPTPPASAAPTAGADLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGL
VEGLVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKA
HQLAVMAGVQAAIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWESFTELYAKILREAEDDFQELF
GREFSRAYEEHSARLRRS
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c169439-167913 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGATACCAGCACCAACGGC
GTGCTGCTGGTCAACGCCGGACATCGCCTGCGCCGCGGCAACAGCGAACCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAGTACGACATCCTCGTCCAGCTCGGCCACGACATCGCCCTGCCCGGCAGCGGCAACCC
GCAGACCGATCCATTCACCAGCTTCGATGCGCTGATGAGCCGGCAGAACGCCGCCACGGCGCCGGCATTT
CCCGAGCCGGCGGCCACCCCGCACCCGGCGGTGGCGGCGCATTTCCAGGGCGGCTCGCCGCTGGATACCA
GGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCACCGCGCCCGGACCACGTGCCGGC
CGAACAGCACGACTTCCGTCCGCCGGAACCGGTGATCCCGCCACCGCCCGCGATCACTCCGGCGCCAGCG
CCCGCTGGCGGTGCGCCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAGCTGCTCGGCAATACGCCCG
CTGCGGGCCCGGCGCCTGCAACGGAACCCCTCGCCACGCCGCTGCCGACGCCGGAGCCGGCACCCCTGGC
GATGCCCTTCGCCGACCCCGGGATCACCCAGCAGCCGCCACAGCCACAGCCACAGCCACAGCCACAGCCA
CAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCAGCGAGCGTGGCGCCGCCGACGC
CGCCGGCAAGCGCCGCCCCCACGGCCGGCGCCGACCTGCTGCAGGCGTTCCTGCGCGGCGCCGGGATGAC
CCAGCTGAAGGTCGACCCGGCCGGCGCCGAGGCGCAGATGGAAGCCATCGGCCGCAGCTATCGCGGCCTG
GTGGAAGGGCTGGTCGACGTGCTGCGTGCGCGGGCCAGCCTGAAGGGCGAGTTCCGCATGGCGCAGACCA
TGATCCAGCCGGTGCAGAACAACCCGCTGAAATTCGCGCCGAACGTCGACGAAGCCATGCTGCTCCTGCT
GCGCCGCGACAACCAGGCGTTCATGGCGCCGGACCGCGCGGTGGCCGACAGCTTCGAGGATCTCAAGGCG
CACCAGCTGGCAGTGATGGCCGGCGTGCAGGCGGCCATCCGCCACCTGCTGGCACGCTTCGAACCGGCCG
CGCTGGAAGCCCGCTTCGGCAAGCCGGCCGGGCTCTCCGGCCTGCTGCCGGGGGCCCGCCAGGCACAGAA
CTGGGAAAGCTTCACCGAGCTGTACGCGAAGATCCTGCGCGAGGCGGAGGATGACTTCCAAGAGCTGTTC
GGCCGCGAATTCAGCCGCGCCTACGAGGAACACAGCGCTCGACTACGGCGTTCCTGA
 Primer design