SecReT6
Protein ID: 152986292
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0146
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]159755..160483 [-]
Productputative phosphoprotein phosphatase
NotePppA
UniProt IDA6UXK7
KEGG IDpap:PSPA7_0146
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.50E-13, Aligned region: 20..209
PP2C [PF00481], Evalue: 2.80E-10, Aligned region: 29..234
SpoIIE [PF07228], Evalue: 6.90E-07, Aligned region: 38..240
Protein Sequence: 242 a.a.     [Download]
>gi|152986292|ref|YP_001345542.1| putative phosphoprotein phosphatase [Pseudomonas aeruginosa PA7]
MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPESGLWVVADGMGGHAAGDFVSSLIVDTLRRIPAASSLP
AYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLVLLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSY
VQELLDNDLISEDEARHHPRANVVTRAVGVHERLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLG
HSDPYAVVRSLVHLGLTRGAPDNITALVVRAF
 
Nucleotide Sequence: 729 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c160483-159755 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGTGCCCAACTCAGTCAGCTACTACAGATCGGCCAGCTACAGCCACGTCGGCATGGTCCGCAAGGTCA
ACGAGGACGCCAGCCTCGACGCCCCCGAGTCCGGGCTCTGGGTGGTCGCCGACGGCATGGGCGGCCACGC
CGCCGGCGACTTCGTCAGCAGCCTGATCGTCGACACCCTGCGGCGCATCCCCGCCGCCTCCTCGCTACCG
GCCTACGTCGGCGCGTTGCGCACCGGCCTGGCCCAGGTCAACGAGCGGGTCCGCCAGGAGGCCGGCCTGC
GCGGCGTCAGCGTGATGGGCAGCACCCTGGTGCTGCTCGCCGCGCGCGGCAACCAGGCGAGCTGCCTGTG
GGCCGGCGACAGCCGCCTGTACCGCCTGCGCGGCGGCGTGCTGGAAGCCATCTCGCGGGACCACAGCTAC
GTCCAGGAACTGCTCGACAACGACCTGATCAGCGAGGACGAGGCGCGCCACCATCCGCGCGCCAACGTGG
TCACCCGCGCGGTCGGCGTGCACGAGCGACTGGAGCTCTCGGAAGCCGCGCTGCACGTGCTGCCCGGCGA
CAGCTTCCTGCTCTGCAGCGACGGCCTCAACAAGACCGCCGACGACAGCGAACTGCGCGACGTGCTCGGC
CACAGCGATCCCTACGCGGTGGTGCGCAGCCTGGTCCACCTGGGCCTGACCCGCGGCGCCCCGGACAACA
TCACGGCCCTGGTGGTCAGGGCCTTCTGA
 Primer design