SecReT6
Protein ID: 152986386
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0161
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]176793..177839 [+]
Producthypothetical protein
NoteTssG
UniProt IDA6UXM2
KEGG IDpap:PSPA7_0161
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-112, Aligned region: 20..319
Protein Sequence: 348 a.a.     [Download]
>gi|152986386|ref|YP_001345557.1| hypothetical protein PSPA7_0161 [Pseudomonas aeruginosa PA7]
MAGEAGQPSEPLSLLAGMAAAPWDYDFFQALRRIECESPQLPRLGHSVRLADDPLRLGQKPDCTFAPSTL
ASVSQAGADAVPRLDQFFFGLTGPNGPLPLHLTEYARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEA
RPEISHDRIDDDYWSARLAALSGRGMPSLRAREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVA
VEEYVGQWLELPERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWV
AEYLGEELDWDVNLVLQRQEIPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPHEHKEKEHE
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|152983466|ref|NC_009656.1|:176793-177839 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGAGCCTGCTCGCCGGGATGGCGGCGGCGCCCTGGG
ACTACGACTTCTTCCAGGCGCTGCGGCGCATCGAGTGCGAGTCGCCGCAACTGCCGCGCCTCGGGCATTC
GGTGCGGCTGGCGGACGATCCGCTGCGCCTCGGGCAGAAGCCCGACTGCACCTTCGCGCCCTCGACCCTG
GCCTCGGTGAGCCAGGCCGGCGCCGACGCGGTGCCGCGCCTGGACCAGTTCTTCTTCGGCCTCACCGGGC
CCAACGGGCCGCTACCGCTGCACCTCACCGAATACGCCCGGGAACGCCAGCGCAACGTCAACGATGCGAC
CTTCAAGCGCTTCATGGACGTCTTCCACCACCGCCTGCTGACCCTGTTCTACCGGGCCTGGGCGGAGGCG
CGACCGGAGATCAGCCACGACCGGATCGACGACGACTACTGGTCGGCACGCCTCGCCGCGCTGTCCGGGC
GCGGCATGCCGAGCCTGCGCGCTCGCGAGCCGCTGGCGGACACCGCGCGCTACTACTACACCGGCCACCT
CGCCGCGCAGACCCGCTACCCGGACGGCCTGCGGGTGATCCTCGCGGAGTATTTCGAGGTCCCGGTGGCG
GTCGAGGAGTACGTCGGCCAGTGGCTGGAGCTGCCCGAGCGCAGCCGCCTCGGCGTCGACTCGACGAGCC
TGGGCATGGACGTCTGCCTGGGCACCCACGTCTGGGATCGCCAGCACAAGTTCCGCCTGCGCCTGGGGCC
GCTGGACCTCGATCAGTACCAGCGCTTCCTGCCCGACGGCGACCACTTCGTCGAGCTGGCCGCCTGGGTC
GCCGAATACCTGGGCGAGGAGCTGGACTGGGACGTCAACCTGGTCCTGCAACGCCAGGAAATACCCCCGC
TGGGCCTGCAGGGCGGCGGGCGGCTCGGTTTCAACACCTGGCTGGGCGATCCCGGCCAGGATGCCAGGGA
TCTACTGCTGGCCCGCCAGTACGCCACTGCGCGGCCGCATGAGCACAAGGAGAAGGAACATGAGTGA
 Primer design