SecReT6
Protein ID: 152987384
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0147
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]160493..161173 [-]
Producthypothetical protein
NoteTagF
UniProt IDA6UXK8
KEGG IDpap:PSPA7_0147
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 9.20E-51, Aligned region: 5..142
Protein Sequence: 226 a.a.     [Download]
>gi|152987384|ref|YP_001345543.1| hypothetical protein PSPA7_0147 [Pseudomonas aeruginosa PA7]
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRFAIAPGLLGDD
AVAGVVMPSIDRVGRYFPLTVACLLPANADLGALVGGDDGWFEQVEGLLLSTLEPEAEVEAFEQAVAQLP
APPCGPRIEQSLISGNLLRSEAATPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRF
LTGEGEVIPLFPGIPG
 
Nucleotide Sequence: 681 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c161173-160493 Pseudomonas aeruginosa PA7 chromosome, complete genome
TTGAACAGCGTCGGTTTCTACGGCAAGCTGGCCGGCCGCGGCGACTTCGTCAGCCGCGGCCTGCCGAACA
CCTTCGTCGAGCCCTGGGACGCCTGGCTGGCCAGCGGCATGCGCGCCAGCCAGGACGAACTCGGCGCGGC
CTGGCTCGACGCCTACCTGACCAGCCCGCTGTGGCGCTTCGCCATCGCCCCCGGCCTGCTCGGCGACGAT
GCGGTGGCCGGAGTGGTGATGCCGAGCATCGACCGGGTCGGCCGCTACTTCCCGCTCACCGTGGCCTGCC
TGCTGCCGGCGAACGCCGACCTCGGCGCGCTGGTCGGCGGCGACGACGGCTGGTTCGAGCAGGTCGAGGG
CCTGCTGCTCTCCACCCTCGAACCGGAAGCCGAGGTCGAAGCCTTCGAGCAGGCGGTGGCGCAGCTCCCG
GCGCCGCCCTGCGGCCCGCGCATCGAGCAGTCGCTGATCAGCGGCAACCTGCTGCGCAGCGAGGCGGCGA
CCCCGGCACAGCGCCTCGCCGCCCTGGCCCAGCACGCCTGCGACGGCGCCAGCCACTGGTGGGGCCGCGG
CTCGGCGCGGATTTCCGCAGGCCTGATGCGCTACCAGGGACTGCCGCCGGCGCCGGCGTTCGGACGATTT
CTCACCGGCGAGGGCGAGGTGATCCCGCTCTTTCCCGGCATACCCGGTTAA
 Primer design