SecReT6
Protein ID: 152987570
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0163
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]180575..182515 [+]
Producthypothetical protein
NoteTssI
UniProt IDA6UXM4
KEGG IDpap:PSPA7_0163
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.40E-89, Aligned region: 29..329
Phage_base_V [PF04717], Evalue: 2.10E-26, Aligned region: 369..462
Protein Sequence: 646 a.a.     [Download]
>gi|152987570|ref|YP_001345559.1| hypothetical protein PSPA7_0163 [Pseudomonas aeruginosa PA7]
MGLMQLTRLVQVDCPLGADVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSLELPGGGR
RFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIRQVFRDLGFSDFEDALTRP
YREWEYCVQYRESSFDFVSRLMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRER
DHFFDWQMAREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIE
ALQAQHERVRLRGVVRGLGAGHLFRLSGYPREDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCI
DASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLYIHAERNQDNLVENDASLIVGHDRNKSVGNDELARIGHNRTRAVKLNDTLLVGGAKSDSVS
GTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDANGKGVQG
TIDGQVQAMFPPPPKA
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|152983466|ref|NC_009656.1|:180575-182515 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGGATTGATGCAACTGACCCGCCTGGTCCAGGTGGATTGCCCGCTGGGGGCGGACGTGCTGCTGTTGC
AGCGCATGGAGGGCCGCGAGGAACTGGGGCGGCTGTTCGCCTACGAGCTGCACCTGGTCTCGGAGAACCC
CAACCTGCCGCTGGAACAGTTGCTCGGCAAGCCGATGAGCCTCTCGCTGGAGCTGCCCGGCGGCGGCCGG
CGCTTCTTCCACGGCATCGTCGCGCGCTGCAGCCAGGTGGCCGGGCACGGCCAGTTCGCCGGCTACCAGG
CCACCCTGCGGCCCTGGCCGTGGCTGCTGACGCGGACCTCGGACTGCCGGATCTTCCAGAACCAGAGCGT
GCCGGAGATCATCAGGCAGGTATTCCGCGACCTCGGCTTTTCCGATTTCGAGGATGCCCTCACGCGCCCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGAGCAGCTTCGACTTCGTCAGCCGGCTGATGGAAC
AGGAGGGCATCTACTACTGGTTCCGCCATGAGCAGAAGCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCATCGCAGCCCGGGTGGCTACGCCAGCGTGCCGTACTACCCGCCGACCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCAGATGGCACGCGAGGTCCAGCCTGGTTCGCTGACCCTCAACGACTACGACT
TCCAGCGCCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGGCCGCACGCGGCGGCCGACTACCC
GCTGTACGACTATCCCGGCGAGTACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGCAACCGCATCGAG
GCGCTCCAGGCGCAGCACGAGCGCGTGCGCCTGCGCGGCGTGGTGCGCGGCCTCGGCGCCGGGCACCTGT
TCCGCCTGAGCGGTTATCCGCGCGAAGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAATACCGGGT
GGTCCAGGAGCTCTACGAAACCGGCAGCGGCGGCGCCGGCTCGCAGTTCGAGAGCGAGCTGGACTGCATC
GACGCCAGCCAGTCGTTCCGTCTCTTGCCGCAGACTCCGGTGCCGGTGGTGCGCGGTCCGCAGACCGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTG
GGATCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATCCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGTTCGATGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTACATCCATGCCGAACGCAACCAGGACAACCTGGTGGAGAACG
ACGCCTCGCTGATCGTCGGCCACGACCGCAACAAGAGCGTCGGCAACGACGAACTGGCGCGCATCGGCCA
CAACCGCACCCGCGCGGTGAAGCTCAACGACACCCTGCTGGTGGGCGGGGCGAAGAGCGATAGCGTCAGC
GGCACCTACCTGATCGAGGCCGGCGCGCAGATCCGCCTGGTCTGCGGCAAGAGCGTGGTGGAGTTCAACG
CCGACGGCACCATCAACATCTCCGGCAGCGCCTTCAACCTCTACGCCAGCGGCAACGGCAACATCGACAC
CGGCGGCCGCCTCGACCTCAATTCCGGCGGCGCCAGCGAGGTCGACGCCAACGGCAAGGGCGTGCAGGGC
ACCATCGACGGCCAGGTGCAGGCGATGTTCCCGCCGCCGCCGAAGGCCTGA
 Primer design