SecReT6
Protein ID: 152988188
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0160
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]174970..176829 [+]
Producthypothetical protein
NoteTssF
UniProt IDA6UXM1
KEGG IDpap:PSPA7_0160
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-223, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|152988188|ref|YP_001345556.1| hypothetical protein PSPA7_0160 [Pseudomonas aeruginosa PA7]
MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGALSSGFSVERGASLRGQLGPEDQTACEYRTAHPVTLWP
LEVVQADYFGNPAAVLGRLAASEPRAKAGLRIRLRSGAGIPFHSLSLDALPLYLHGADEQPYRLYEQLLG
NACAVFVRAPDNAWVERLPASSLRPRGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRAL
RRCAGEELELIVLFGKHDARLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVIVDRTRPLDFE
VHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSKQRRKGPRSTYVGSETFVALVD
ASQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHRSDFTLEDSAPVMQVRCLAGPSRPRASRAHDASAWRL
ISQLSLNYLSLAERGQGAAALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEIT
LDFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|152983466|ref|NC_009656.1|:174970-176829 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAACCCGCGCCTGCTCGAGTACTACAACCAGGAACTGCAACACATCCGCGAAAGCGCCGCGGAGTTCG
CCGAGGAATTCCCGAAGATCGCCGGGCGCCTGTCGCTGTCCGGCTTCGAGTGCGCCGACCCCTATGTCGA
GCGCCTGCTGGAAGGCTTCGCCTATCTCACCGCGCGGGTCCAGCTGAAGCTCGACGCGGAATACCCGACC
TTCACCCACAACCTGCTGGAAATCGCCTATCCGCACTACCTGGCGCCGACCCCCTCGATGACCGTGGTGC
AGTTGCGCCCGGACCCCAACGAAGGCGCCCTGAGCAGCGGTTTCAGCGTCGAGCGCGGGGCCTCCCTGCG
TGGCCAGCTCGGCCCCGAGGACCAGACCGCCTGCGAGTACCGCACCGCGCACCCGGTGACCCTGTGGCCG
CTGGAAGTGGTCCAGGCCGACTACTTCGGCAACCCGGCCGCGGTGCTCGGGCGTCTCGCCGCCAGCGAGC
CGCGGGCCAAGGCCGGCCTGCGCATCCGCCTGCGCAGCGGCGCCGGCATTCCGTTCCACAGCCTGTCGCT
GGACGCCCTGCCGCTCTACCTGCACGGGGCCGACGAACAGCCCTATCGTCTCTACGAGCAGTTGCTCGGC
AACGCCTGCGCGGTGTTCGTCCGCGCCCCGGACAACGCCTGGGTCGAGCGCCTGCCGGCGAGCAGCCTGC
GGCCGCGCGGCTTCGACGACGAGGACGCGCTGCTGCCGGTGGTGCCGCGGGCGTTCCAGGGCTACCGCCT
GCTGCAGGAATACTTCGCCCTGCCGGCGCGCTTCCTGTTCGTCGAGTTCTCCGGGCTGAATCGCGCCCTG
CGTCGCTGCGCCGGCGAGGAACTGGAGCTGATCGTGCTGTTCGGCAAGCACGACGCGCGCCTGGAGGGCA
CGGTGGACGCCGAGCAACTGGTGCCGTTCTGCACCCCGGCGATCAACCTGTTCCCGCGTCGCTGCGACCG
CATCCACCTGTCCGACCGGGTCAACGAGCACCATGTGATCGTCGACCGCACCCGGCCGCTGGACTTCGAG
GTGCATTCGCTGCAGCAGGTCAGCGGCCACGGCAGCGGTCCGGAGCAACCCTTCCAGCCGTTCTACGCGG
TGCGCGATCCGGCGCGCTACGGCCGCGAGCAGGCCTACTTCAGCGTGCGCCGCGAACCGCGCGTGCTGTC
CAGCAAGCAGCGGCGCAAGGGCCCACGTTCGACCTATGTCGGCAGCGAGACCTTCGTCGCCCTGGTCGAC
GCCAGCCAGGCGCCCTATCGCCACGACCTGCGCCAGCTCGGCATCGCCGCGCTGTGCACCAACCGCGACC
TGCCGCTGTTCATGCCGATCGGCGCGCACAGGAGCGACTTCACCCTGGAGGACAGCGCGCCGGTCATGCA
GGTGCGCTGCCTCGCCGGACCGAGCCGGCCGCGCGCCAGCCGTGCCCACGATGCCAGCGCCTGGCGGCTG
ATCAGCCAGCTGTCGCTGAACTACCTGTCGCTGGCCGAGCGCGGCCAGGGCGCCGCCGCTCTGCGCGAAC
TGCTGCGGCTCTACGGCGACAGCGGCGATCCGGCGCTGCAGTTGCAGATCGAGGGCCTGCGCGAGGTCAG
CAGCAAGCCCTGCACGCGGCGCCTGCCGATGCCCGGGCCGATCGTCTTCGGCCGCGGCCTGGAGATTACC
CTGGACTTCGACGAGAACGCGTTCCGCGGTACCGGGGTGTTCCTCCTCGGCGCGGTGTTCGAGCGCTTCC
TGGCACGCTACGTGTCGATCAACAGCTTTACCGAGACGGTGCTGCGCACCGGCGAACGGGGCGAGGTGAT
GAGATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGA
 Primer design