SecReT6
Protein ID: 152988561
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0150
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]166053..167387 [-]
Producthypothetical protein
NoteTssK
UniProt IDA6UXL1
KEGG IDpap:PSPA7_0150
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-158, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|152988561|ref|YP_001345546.1| hypothetical protein PSPA7_0150 [Pseudomonas aeruginosa PA7]
MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGFSELKLDDALLTQGKLAVLSARGVLP
DGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPLKRVGTRDTAEEGEALGGARYVSQVQEVRDDNAAFES
RAPVALGSQAFRLLTERDGLGEYAALGIARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLL
HQRGEALAGRVVASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQ
RRPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRNLIDNASFILVVR
ADVPGETLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPYHAGSTYFELDRGSAHWKQLTH
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c167387-166053 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGTCCTGGAATAACCGCGTGGTGTGGTCCGAAGGCATGTTCCTGCGGCCGCAACATTTCCAGCAGCACG
ACCGCTACCTGGAAACCCTGGTGGATGGCCGCTGCCGCTCGCTCCTGGCGGGTGGCTGGGGCTTCTCCGA
ACTGAAGCTGGACGACGCCCTGCTGACCCAGGGCAAGCTCGCCGTGCTCAGCGCCCGCGGCGTGCTGCCG
GACGGTACGCCGTTCAACATCCCCGCCGACGACCCGGCGCCGGCACCGCTGAACGTCGAGGAAAGCCTGC
GCGACGGCATCGTCTACCTCGGCCTGCCGCTGAAACGGGTCGGCACCCGCGACACGGCGGAGGAGGGCGA
GGCCCTCGGCGGCGCCCGCTACGTCAGCCAGGTGCAGGAAGTGCGCGACGACAACGCCGCCTTCGAGAGC
CGCGCGCCGGTGGCCCTGGGCAGCCAGGCGTTCCGCCTGCTGACCGAGCGCGACGGCCTCGGCGAGTACG
CCGCGCTGGGCATCGCGCGGGTCCGCGAGAAGCGCGCCGACCAGGCCCTGAGCCTGGACGAGGACTACCT
GCCGCCGGTACTCGATATCGCCGCCGCGCCGCCCCTGGCGTCCTTCGCCAAGGAACTGCTGGGCCTGCTC
CACCAGCGCGGCGAGGCCCTCGCCGGACGGGTGGTGGCCTCCAGCGCCGGTGGCGCCTCGGAGATCGCCG
ATTTCCTGCTGCTGCAACTGGTCAACCGCGCCGAGGCGCTCACCGGCCACCTGTCCCGCGTGCGCCCGCT
GCACCCGCAGGAGCTGTACCGCGAGCTGGTGGCCCTGGCCGGCGAGTTCTGCACCTTCACCGCCAGCCAG
CGGCGTCCCGAGGAGTACCCGGTGTACAACCACGACGACCTGGCCGCCAGCTTCGCCCCGGTGATGCTCG
CCCTGCGCCAGGCGCTGGCGACGGTGATCGACGCCAAGGCGATCGCCATCCCGATCGTCGAGAAGGCCTA
CGGTGTGCATGTCGCCATGCTCAGCGACCGCAACCTGATCGACAACGCCAGCTTCATCCTGGTGGTGCGC
GCCGACGTGCCCGGCGAGACCCTGCGCGGGCACTTCCCGCAGCAGGCCAAGGTCGGCTCGGTGGAACACA
TCCGCGACCTGGTCAACCTGCAGCTGCCGGGCATCGGCCTGCTGCCGATGCCGGTGGCGCCGCGGCAGAT
CCCCTACCACGCCGGCTCCACCTATTTCGAACTGGACCGCGGCAGCGCGCACTGGAAGCAGCTGACGCAC
TCCGGCGGCTTCGCCTTCCACATCGCCGGCCAGTTCCCCGGGCTGAACCTGGCCTTCTGGGCCATTCGAG
GATAA
 Primer design