SecReT6
Protein ID: 152988565
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0158
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]173677..174462 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDA6UXL9
KEGG IDpap:PSPA7_0158
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.20E-43, Aligned region: 138..256
TPR_16 [PF13432], Evalue: 6.10E-08, Aligned region: 2..55
TPR_16 [PF13432], Evalue: 6.10E-08, Aligned region: 113..122
TPR_19 [PF14559], Evalue: 2.00E-05, Aligned region: 6..62
TPR_19 [PF14559], Evalue: 2.00E-05, Aligned region: 111..130
TPR_14 [PF13428], Evalue: 0.00014, Aligned region: 2..39
TPR_14 [PF13428], Evalue: 0.00014, Aligned region: 36..53
TPR_14 [PF13428], Evalue: 0.00014, Aligned region: 93..111
TPR_11 [PF13414], Evalue: 0.0012, Aligned region: 3..53
TPR_11 [PF13414], Evalue: 0.0012, Aligned region: 101..110
Protein Sequence: 261 a.a.     [Download]
>gi|152988565|ref|YP_001345554.1| virulence protein, SciE type [Pseudomonas aeruginosa PA7]
MIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQWTRALNQLKVVGELDASALPMVQTY
STAIECEALRREVFAGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQGLREQAFDAAPAVPGRIGETP
FAWLADADTRLGPVLEVIVNGRYAWLPMSNLRSLQVEAPSDLRDLVWLPAELTLANGGATVALLPARYAE
TVEHGDDAARLGRKTEWLESGLPLGQRLFVTDAGETALFDLRRLDFEATDA
 
Nucleotide Sequence: 786 bp     [Download]
>gi|152983466|ref|NC_009656.1|:173677-174462 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGATCGCCGAAGAACTGTTGCGTGCCGGGCGCCTGGACGACGCGCTGAAAGCCTTGCAGGAGCAGGTGC
GCAGCCAGCCGTCGAACGCCACCCTGCGGATCTTCCTGTTCCAGCTGCTGGCGGTGATGGGCCAGTGGAC
GCGGGCGCTGAACCAGCTCAAGGTGGTCGGCGAACTGGACGCCTCGGCACTGCCGATGGTGCAGACCTAC
TCCACCGCCATCGAGTGCGAGGCGTTGCGCCGCGAGGTGTTCGCCGGGCGCCTGACCCCGGTGATCCTCG
GCCAGCCGGCGGAATGGATCGCGCCGCTGCTGCAGGCCCTGAGCCTGGACGCCGAGGGCCATGGCGAAGC
CGCCCAGGGCTTGCGCGAGCAGGCTTTCGACGCGGCGCCGGCGGTGCCCGGGCGGATCGGCGAGACGCCC
TTCGCCTGGCTGGCCGACGCCGACACCCGGCTCGGCCCGGTACTCGAGGTGATCGTCAACGGCCGCTATG
CCTGGCTGCCGATGAGCAACCTGCGCAGCCTCCAGGTCGAGGCGCCGAGCGACCTGCGCGACCTGGTCTG
GCTGCCGGCCGAACTGACCCTGGCCAACGGCGGCGCCACCGTCGCGCTGTTGCCGGCGCGCTACGCGGAA
ACCGTCGAGCACGGCGATGACGCCGCGCGCCTCGGGCGCAAGACCGAGTGGCTGGAGAGCGGCCTGCCGC
TCGGCCAGCGGCTGTTCGTCACCGACGCCGGCGAAACCGCGCTGTTCGACCTGCGCCGCCTGGACTTCGA
GGCGACGGACGCCTGA
 Primer design