SecReT6
Protein ID: 152988906
SecReT6 ID219
T6SS typei1
Gene symbol-
Locus tagPSPA7_3609
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3735362..3736873 [-]
Productputative transcriptional regulator
NoteSfa2
UniProt IDA6V7C8
KEGG IDpap:PSPA7_3609
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 2.60E-70, Aligned region: 195..362
Sigma54_activ_2 [PF14532], Evalue: 1.40E-22, Aligned region: 196..366
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 352..359
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 454..493
AAA_5 [PF07728], Evalue: 1.30E-06, Aligned region: 219..337
GAF_3 [PF13492], Evalue: 2.40E-06, Aligned region: 30..178
GAF_3 [PF13492], Evalue: 2.40E-06, Aligned region: 202..261
GAF_2 [PF13185], Evalue: 0.00018, Aligned region: 44..178
GAF_2 [PF13185], Evalue: 0.00018, Aligned region: 286..290
HTH_30 [PF13556], Evalue: 0.00027, Aligned region: 463..495
Protein Sequence: 503 a.a.     [Download]
>gi|152988906|ref|YP_001348963.1| putative transcriptional regulator [Pseudomonas aeruginosa PA7]
MFSRVAQPLSFAEALLAQFTALSRETDASALLGGFACAVGKLCGCELSQLYLLDQTHTVLTLSAECRDGL
PQALEPSILPADYNGEQLLQFALCQNRVVSLVDLPARLHETGFLPLRDKPWLSLLCVPLMSPEKTVGGVV
VCATLRPLNLQGFAHALGQLGSFVLAQLHLLQRLAHPASEPQGPSSAPVVSGYGLIGRSAAMRETCRMIS
KVLHTPYTVLLQGETGTGKEVVARAIHEYGPRRSQAFVVQNCAAFPENLLESELFGYRKGAFTGAERDRP
GLFDAADGGTLLLDEIGDMSLPLQAKLLRVLQEGEIRPLGGNDTHKVDVRIIAATHRDLALLVRDGKFRE
DLYYRLAQFPIELPPLRQREGDALELARHFAERACVFLRRAPLGWSAEALELLEGYGFPGNVRELKGLVE
CAVLLCEGDVLLAEHFSLRAPPEAEAPLKLREHLEQIERDLLLACLRRNAGNQTLAARELGLPRRTLIYR
MGRLNIHFGDPRT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3736873-3735362 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGTTCAGTCGTGTTGCGCAACCGCTGTCCTTTGCCGAAGCCCTGCTGGCGCAGTTCACCGCGCTGTCAC
GGGAAACCGATGCCTCGGCCTTGCTGGGAGGCTTCGCGTGCGCTGTCGGTAAGCTCTGCGGATGCGAGCT
GAGCCAACTGTACCTGCTCGACCAGACCCATACGGTGCTCACACTCAGCGCCGAGTGCCGCGATGGCCTG
CCGCAGGCGCTGGAGCCCTCCATCCTGCCGGCAGACTACAACGGCGAGCAACTGCTGCAGTTCGCTCTTT
GTCAGAACCGTGTGGTCAGCCTCGTTGACCTTCCGGCCCGGCTGCACGAGACCGGCTTCCTGCCGCTACG
GGACAAGCCGTGGCTGTCCCTGCTGTGCGTGCCGCTGATGAGCCCGGAAAAAACGGTAGGAGGGGTGGTT
GTCTGCGCCACCCTGCGGCCACTGAACCTGCAGGGGTTCGCCCATGCGCTGGGCCAGCTCGGCTCGTTCG
TGCTGGCCCAGTTGCATTTGCTGCAGCGCCTGGCGCATCCCGCCAGTGAGCCGCAGGGACCATCCAGTGC
GCCGGTGGTCAGCGGCTACGGGCTGATCGGTCGGAGCGCGGCGATGCGCGAGACCTGCCGGATGATCAGC
AAGGTCCTGCATACCCCCTACACGGTACTGCTGCAGGGCGAGACCGGTACCGGCAAGGAGGTGGTCGCAC
GGGCGATCCACGAGTACGGTCCGCGACGTTCGCAGGCCTTCGTGGTGCAGAACTGCGCGGCGTTTCCGGA
AAACTTGCTGGAGAGCGAACTGTTCGGCTACCGAAAGGGCGCTTTTACCGGTGCCGAACGCGACCGCCCC
GGGCTGTTCGACGCCGCCGACGGCGGAACCCTGTTGCTCGACGAGATCGGCGACATGTCCCTGCCGCTCC
AGGCCAAGCTGTTGCGCGTGCTGCAGGAAGGCGAGATTCGCCCGCTCGGCGGCAACGATACGCACAAGGT
CGATGTACGCATCATCGCCGCTACCCACCGTGACCTCGCCCTGCTGGTACGCGATGGCAAGTTCCGCGAA
GACCTCTACTACCGACTGGCGCAGTTTCCCATCGAGTTGCCGCCGTTGCGCCAGCGCGAGGGCGACGCCC
TCGAACTGGCCCGGCATTTCGCCGAACGCGCCTGCGTGTTCCTGCGTCGCGCGCCGCTGGGCTGGTCCGC
GGAAGCGCTGGAACTGCTCGAGGGCTATGGCTTTCCCGGCAACGTTCGGGAGCTGAAGGGACTGGTGGAA
TGCGCGGTATTGCTCTGCGAAGGCGACGTGCTGCTGGCCGAACACTTTTCCCTGCGCGCCCCGCCGGAAG
CGGAGGCGCCACTCAAGCTGCGCGAGCATCTGGAGCAGATCGAACGGGACCTGCTGCTCGCCTGCCTGCG
CAGGAACGCTGGCAACCAGACCCTCGCCGCGCGCGAACTGGGTCTGCCGCGCCGAACCCTGATCTATCGC
ATGGGACGCCTGAACATTCATTTCGGCGATCCCCGGACCTGA
 Primer design