SecReT6
Protein ID: 152989614
SecReT6 ID217
T6SS typei3
Gene symbol-
Locus tagPSPA7_0162
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]177832..180540 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDA6UXM3
KEGG IDpap:PSPA7_0162
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-38, Aligned region: 236..251
AAA_2 [PF07724], Evalue: 1.00E-38, Aligned region: 631..797
AAA [PF00004], Evalue: 8.10E-19, Aligned region: 234..367
AAA [PF00004], Evalue: 8.10E-19, Aligned region: 637..721
ClpB_D2-small [PF10431], Evalue: 1.10E-14, Aligned region: 804..878
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 354..364
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 636..752
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 34..78
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 211..250
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 606..681
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 57..98
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 344..406
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 634..657
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 698..718
Sigma54_activat [PF00158], Evalue: 9.10E-07, Aligned region: 213..248
Sigma54_activat [PF00158], Evalue: 9.10E-07, Aligned region: 635..758
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 285..388
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 636..657
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 707..718
AAA_25 [PF13481], Evalue: 2.00E-05, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 2.00E-05, Aligned region: 486..508
AAA_25 [PF13481], Evalue: 2.00E-05, Aligned region: 535..556
AAA_25 [PF13481], Evalue: 2.00E-05, Aligned region: 634..661
Zeta_toxin [PF06414], Evalue: 4.60E-05, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 4.60E-05, Aligned region: 630..676
IstB_IS21 [PF01695], Evalue: 0.00037, Aligned region: 217..255
IstB_IS21 [PF01695], Evalue: 0.00037, Aligned region: 636..664
AAA_18 [PF13238], Evalue: 0.00063, Aligned region: 234..251
AAA_18 [PF13238], Evalue: 0.00063, Aligned region: 531..566
AAA_18 [PF13238], Evalue: 0.00063, Aligned region: 638..661
Clp_N [PF02861], Evalue: 0.00069, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.00069, Aligned region: 108..145
AAA_19 [PF13245], Evalue: 0.00081, Aligned region: 234..255
AAA_19 [PF13245], Evalue: 0.00081, Aligned region: 634..658
NACHT [PF05729], Evalue: 0.0013, Aligned region: 234..261
NACHT [PF05729], Evalue: 0.0013, Aligned region: 637..663
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 634..661
AAA_17 [PF13207], Evalue: 0.0018, Aligned region: 234..248
AAA_17 [PF13207], Evalue: 0.0018, Aligned region: 502..502
AAA_17 [PF13207], Evalue: 0.0018, Aligned region: 636..671
Torsin [PF06309], Evalue: 0.0028, Aligned region: 593..660
Protein Sequence: 902 a.a.     [Download]
>gi|152989614|ref|YP_001345558.1| type VI secretion ATPase [Pseudomonas aeruginosa PA7]
MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQILQLPDSDLHQIVRQSGIDPARLAKD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAK
LKVEALTERFDEYVGASPENGLSASDGFNAGAAPGEASGAMAPSAMGRQEALKRFTVDLTEQARSGKLDP
IVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLLQAGA
SMKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEQHHQVQILDEALEAAVRLSHRYIPARQLPDK
SVSLLDTACARTAISLHAVPAEVDDSRRRIEALETELAIIRRESAIGVATGERQRNAETLLAEERERLAG
LERRWAEEKRLVDELLETRARLRAAAEAVDAGGTPLGEGEARLDEEQRQALHARLAELQAQLSALQGEEP
LILPTVDYQAVASVVADWTGIPVGRMARNEIETVLNLDSHLKKRIIGQDHALEMIAKRIQTSRAGLDNPS
KPIGVFMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEA
VRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRLIDFKNTLILLTTNAGTEMIASLCADPELM
PEPEAIAKSLREPLLKIFPPALLGRLVTIPYYPLSDDMLKAISRLQLGRIKKRVEATHKVPFEFDEGVVD
LIVSRCTETESGGRMIDAILTNTLLPDMSREFLTRMLEGKPLAGVRISSRDNQFHYDFATAD
 
Nucleotide Sequence: 2709 bp     [Download]
>gi|152983466|ref|NC_009656.1|:177832-180540 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAGTGAGATCAGTCGCGTTGCGCTGTTCGGCAAGCTGAACAGCCTGGCCTACAAGGCCATCGAGGCCG
CCACGGTATTCTGCAAGCTGCGCGGCAATCCCTATGTCGAGCTGGTGCACTGGTTCCACCAGATCCTCCA
GTTGCCGGACTCGGACCTGCACCAGATCGTCCGCCAGTCCGGGATCGACCCGGCGCGCCTGGCCAAGGAC
CTGACCGAGGCCCTCGACCGCCTGCCGCGCGGCTCGACCTCGATCACCGACCTGTCCTCCCATGTCGAGG
AGGCGGTGGAGCGCGGCTGGGTCTACGGCAGCCTGATGTTCGGCGAGAGCCAGGTGCGCACCGGCTACCT
GGTGATCGGCATCCTCAAGACGCCGAGCCTGCGCCATGCCCTCACCGGGCTGTCGGCGGAATTCGCCAAG
CTCAAGGTCGAGGCGCTCACCGAGCGCTTCGACGAGTACGTCGGCGCCTCGCCGGAGAACGGCCTGTCGG
CCAGCGACGGCTTCAACGCCGGCGCCGCCCCGGGCGAGGCCAGCGGCGCCATGGCGCCGAGCGCGATGGG
CAGGCAGGAGGCGCTCAAGCGCTTCACCGTGGACCTCACCGAGCAGGCCCGCAGCGGCAAGCTCGATCCC
ATCGTCGGGCGTGACGAGGAGATCCGCCAACTGGTGGACATCCTCATGCGCCGCCGGCAGAACAACCCGA
TCCTCACCGGCGAGGCCGGCGTCGGCAAGACCGCGGTGGTGGAAGGCTTCGCCCTGCGCATCGTCGCCGG
CGACGTCCCGCCGGCGCTGAAGGACGTCGAACTGCGCGCCCTCGACGTCGGCCTGCTGCAGGCCGGGGCG
AGCATGAAGGGCGAGTTCGAGCAGCGCCTGCGCCAGGTGATCGAGGACGTGCAGAGTTCCGAGAAGCCGA
TCATCCTGTTCATCGACGAAGCCCACACCCTGGTCGGCGCCGGTGGCGCGGCCGGCACCGGCGACGCCGC
CAACCTGCTCAAGCCGGCGCTGGCGCGCGGCACCCTGCGCACCGTGGCGGCGACCACCTGGGCCGAGTAC
AAGAAGCACATCGAGAAAGACCCGGCGCTGACCCGGCGCTTCCAGGTGGTGCAGGTGGACGAGCCGTCCG
AGCACAAGGCGATCCTGATGATGCGCGGCGTCGCCTCGACCATGGAGCAGCACCACCAGGTGCAGATCCT
CGACGAGGCGCTGGAGGCGGCGGTCCGGCTGTCGCACCGCTACATCCCGGCGCGCCAGCTGCCGGACAAG
TCGGTGAGCCTGCTGGATACCGCCTGCGCGCGCACCGCCATCAGCCTGCACGCGGTGCCGGCCGAGGTCG
ACGACAGCCGCCGGCGCATCGAGGCGCTGGAAACCGAACTGGCGATCATCCGCCGCGAGAGCGCCATCGG
CGTCGCCACCGGCGAACGCCAGCGCAACGCCGAGACCCTGCTGGCCGAGGAGCGCGAGCGCCTGGCCGGC
CTGGAGCGGCGCTGGGCCGAGGAAAAACGCCTGGTCGACGAACTGCTGGAGACCCGTGCCCGCCTGCGCG
CCGCCGCCGAGGCGGTGGACGCCGGCGGCACGCCGCTGGGCGAGGGCGAGGCGCGTCTCGACGAGGAGCA
GCGCCAGGCGCTGCATGCGCGGCTGGCGGAACTGCAGGCGCAACTGAGCGCGTTGCAGGGCGAGGAACCG
CTGATCCTGCCGACCGTGGACTACCAGGCAGTGGCCTCGGTGGTCGCCGACTGGACCGGGATTCCGGTCG
GGCGCATGGCGCGCAACGAGATCGAGACCGTGCTCAATCTCGACAGCCACCTGAAGAAACGCATCATCGG
CCAGGACCACGCGCTGGAGATGATCGCCAAGCGCATCCAGACCTCCCGCGCCGGCCTCGACAACCCGAGC
AAGCCGATCGGCGTGTTCATGCTCGCCGGCACCTCCGGGGTGGGCAAGACCGAGACCGCGCTGGCGCTGG
CCGAGGCCATGTACGGCGGCGAGCAGAACGTCATCACCATCAACATGAGCGAGTTCCAGGAAGCCCACAC
CGTCTCCACCCTCAAGGGCGCCCCGCCCGGCTACATCGGCTACGGCGAAGGCGGCGTGCTGACCGAGGCG
GTGCGCCGCAAGCCCTACAGCGTGGTGCTGCTGGACGAAGTGGAGAAGGCCCACCCGGACGTCCACGAGA
TCTTCTTCCAGGTCTTCGACAAGGGCGTGATGGAGGACGGCGAAGGCCGGCTGATCGACTTCAAGAACAC
CCTGATCCTGCTCACCACCAACGCCGGCACCGAGATGATCGCCAGCCTCTGCGCCGATCCGGAACTGATG
CCCGAGCCGGAAGCCATCGCCAAGTCGCTGCGCGAGCCGCTGCTGAAAATCTTCCCGCCGGCGCTGCTCG
GCCGCCTGGTGACCATCCCCTACTACCCGCTCAGCGACGACATGCTCAAGGCCATCTCGCGCCTGCAACT
GGGGCGGATCAAGAAGCGCGTGGAGGCGACCCACAAGGTGCCGTTCGAGTTCGACGAGGGCGTCGTCGAC
CTGATCGTCTCGCGCTGCACCGAGACCGAGAGCGGCGGGCGGATGATCGACGCTATCCTCACCAACACGC
TGCTGCCGGACATGAGCCGCGAGTTCCTCACCCGCATGCTCGAAGGCAAGCCGTTGGCCGGGGTGCGCAT
CAGCAGCCGCGACAACCAGTTCCACTACGACTTCGCCACGGCCGACTGA
 Primer design