SecReT6
Protein ID: 152995212
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1183
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1319447..1321531 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA6VUI3
KEGG IDmmw:Mmwyl1_1183
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-65, Aligned region: 43..336
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 375..467
DUF2345 [PF10106], Evalue: 8.70E-05, Aligned region: 581..623
Protein Sequence: 694 a.a.     [Download]
>gi|152995212|ref|YP_001340047.1| Rhs element Vgr protein [Marinomonas sp. MWYL1]
MATLTFTLALDGMEDNTLLVREYQGHESLSDSLLKDGSPCYGFRYQLALASRQSDLSADTIVDKNAELRV
FRNGELIQRVHGIVRHFEKGDTGHHFTYYGLTLVPALERLSLRHNSRIFQKQTAQDIISQLLNEMGITEH
LFDTQRTPLEREFCVQYRESDLDFVHRLAAEEGWVYYFTHEEGKHQLHFADQSQLLPKHPTPIPYNVLSG
GGSDDQYIATLTHRTQSLPSQAVLKDYSFKKPDYRFLHQQDGENLDYQLPNYEHYDAPGRFKDDVTGKAF
SRIRLEYLRRSARTLVGESNHAAIQAGLKITIEGHSEDSINQEWLPVSVEHHGTQPQVLEEEGQSGSTNY
SNTFTFIPATTNWQATPQPKPSVDGPMMAIVVGPEGEEIFCDEHGRVKLHFPWDRYSEANDHSSCWVRVS
QGWAGNQHGMMAIPRIGSEVIVSFLNGDPDQPIVTGRTFNAKNTPPYLLPDHKTKTVWRSDTHQGEGFNE
ISFEDQVDNEKVYVHAQKDMETDVLNDRITHIGHDQHGQIDNDRFTQIGGENGTGNDHLTIKGESRHKID
KDQSISIDGNLQQKVGKIAILEAGEEIHIKSGDKTVIEAGAEITLAAGGSFVKIDGGGVHLVGSVINLNS
GGSPSAGSGFSGKLPISPLAEELPVSNEKVEEKSAPPTTQKSTLVMAAEEGNPICEECQAAANT
 
Nucleotide Sequence: 2085 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1319447-1321531 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGCTACATTGACGTTTACACTGGCACTCGACGGCATGGAAGACAACACTCTGCTTGTCCGAGAATACC
AAGGGCACGAATCGCTCTCCGATTCCCTGCTAAAAGACGGCTCGCCTTGTTATGGCTTCCGTTACCAATT
GGCCCTCGCCAGCCGTCAATCGGATCTGTCTGCTGATACCATCGTCGATAAAAACGCCGAGCTGCGCGTG
TTTCGTAACGGCGAACTGATTCAACGAGTGCACGGCATTGTTCGTCATTTTGAAAAAGGCGACACCGGCC
ACCACTTTACCTACTACGGCTTAACCTTGGTTCCAGCATTGGAACGCTTATCTTTACGTCACAACAGCCG
TATCTTCCAAAAGCAAACCGCGCAAGACATCATCAGCCAACTGCTGAATGAAATGGGCATCACCGAACAC
TTGTTTGATACCCAACGTACACCGCTTGAACGTGAGTTCTGTGTCCAGTATCGTGAAAGTGACTTAGACT
TTGTCCACCGTTTGGCGGCCGAAGAAGGCTGGGTCTACTACTTCACCCACGAAGAAGGCAAACACCAACT
GCACTTTGCGGATCAAAGCCAACTACTGCCCAAACACCCAACCCCGATTCCGTACAACGTCTTATCGGGT
GGCGGCTCAGACGATCAATACATCGCCACCCTGACACACCGTACACAAAGCTTGCCTAGCCAAGCGGTGC
TCAAAGACTACAGCTTCAAAAAACCGGACTACCGCTTCTTGCACCAACAAGACGGCGAGAACCTAGACTA
CCAACTGCCAAACTACGAACACTACGATGCCCCTGGGCGCTTCAAAGACGACGTCACAGGCAAAGCCTTT
TCACGCATCCGTCTAGAATACCTACGCCGCAGTGCGCGAACCTTAGTAGGAGAAAGCAACCACGCCGCCA
TCCAAGCGGGCCTAAAAATCACCATCGAAGGCCACAGCGAAGACAGCATCAACCAAGAATGGTTGCCCGT
CTCGGTTGAACATCACGGCACCCAACCGCAAGTCTTGGAAGAAGAAGGCCAATCAGGCAGCACAAACTAC
AGCAATACATTTACCTTCATCCCCGCCACCACCAACTGGCAAGCGACACCGCAACCCAAACCCAGTGTCG
ATGGCCCCATGATGGCCATTGTGGTGGGGCCCGAAGGGGAAGAAATCTTCTGTGACGAACACGGACGAGT
CAAACTGCACTTCCCGTGGGACCGCTACAGCGAAGCCAACGACCATAGCTCCTGCTGGGTACGTGTCTCC
CAAGGCTGGGCTGGCAACCAACACGGCATGATGGCGATTCCACGAATCGGCAGCGAAGTCATTGTCAGCT
TTTTAAATGGCGACCCAGATCAACCGATCGTGACCGGACGCACCTTTAACGCCAAAAACACCCCGCCGTA
CCTTTTGCCTGACCATAAAACCAAAACCGTGTGGCGCAGCGATACTCACCAAGGCGAAGGCTTCAACGAG
ATCAGTTTTGAGGATCAAGTCGACAACGAAAAAGTCTATGTCCACGCGCAAAAAGACATGGAAACCGATG
TGCTCAACGACCGCATCACCCACATCGGCCACGACCAACACGGACAAATCGACAACGACCGCTTCACCCA
AATCGGTGGTGAAAACGGCACAGGCAATGACCACCTGACCATCAAAGGTGAAAGTCGTCATAAGATAGAT
AAAGACCAATCCATCAGTATTGATGGGAACTTACAGCAAAAGGTCGGAAAAATTGCCATATTAGAGGCAG
GTGAAGAAATACACATCAAGAGCGGTGACAAAACCGTGATTGAAGCAGGAGCAGAAATCACCCTTGCCGC
AGGCGGCAGCTTCGTCAAAATTGACGGCGGCGGTGTCCACCTAGTCGGCTCTGTTATCAACCTGAACTCT
GGCGGTAGCCCAAGTGCGGGTAGTGGGTTTTCAGGGAAGTTGCCTATATCTCCACTGGCTGAAGAACTGC
CTGTTTCTAATGAGAAAGTGGAAGAAAAAAGCGCGCCTCCGACTACACAGAAGTCCACACTTGTTATGGC
TGCTGAGGAAGGTAATCCAATATGTGAAGAGTGTCAGGCGGCAGCGAACACATAG
 Primer design