SecReT6
Protein ID: 152995212
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1183
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1319447..1321531 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA6VUI3
KEGG IDmmw:Mmwyl1_1183
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-65, Aligned region: 43..336
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 375..467
DUF2345 [PF10106], Evalue: 8.70E-05, Aligned region: 581..623
Protein Sequence: 694 a.a.     [Download]
>gi|152995212|ref|YP_001340047.1| Rhs element Vgr protein [Marinomonas sp. MWYL1]
MATLTFTLALDGMEDNTLLVREYQGHESLSDSLLKDGSPCYGFRYQLALASRQSDLSADTIVDKNAELRV
FRNGELIQRVHGIVRHFEKGDTGHHFTYYGLTLVPALERLSLRHNSRIFQKQTAQDIISQLLNEMGITEH
LFDTQRTPLEREFCVQYRESDLDFVHRLAAEEGWVYYFTHEEGKHQLHFADQSQLLPKHPTPIPYNVLSG
GGSDDQYIATLTHRTQSLPSQAVLKDYSFKKPDYRFLHQQDGENLDYQLPNYEHYDAPGRFKDDVTGKAF
SRIRLEYLRRSARTLVGESNHAAIQAGLKITIEGHSEDSINQEWLPVSVEHHGTQPQVLEEEGQSGSTNY
SNTFTFIPATTNWQATPQPKPSVDGPMMAIVVGPEGEEIFCDEHGRVKLHFPWDRYSEANDHSSCWVRVS
QGWAGNQHGMMAIPRIGSEVIVSFLNGDPDQPIVTGRTFNAKNTPPYLLPDHKTKTVWRSDTHQGEGFNE
ISFEDQVDNEKVYVHAQKDMETDVLNDRITHIGHDQHGQIDNDRFTQIGGENGTGNDHLTIKGESRHKID
KDQSISIDGNLQQKVGKIAILEAGEEIHIKSGDKTVIEAGAEITLAAGGSFVKIDGGGVHLVGSVINLNS
GGSPSAGSGFSGKLPISPLAEELPVSNEKVEEKSAPPTTQKSTLVMAAEEGNPICEECQAAANT
 
Nucleotide Sequence: 2085 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1319447-1321531 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGCTACATTGACGTTTACACTGGCACTCGACGGCATGGAAGACAACACTCTGCTTGTCCGAGAATACC
AAGGGCACGAATCGCTCTCCGATTCCCTGCTAAAAGACGGCTCGCCTTGTTATGGCTTCCGTTACCAATT
GGCCCTCGCCAGCCGTCAATCGGATCTGTCTGCTGATACCATCGTCGATAAAAACGCCGAGCTGCGCGTG
TTTCGTAACGGCGAACTGATTCAACGAGTGCACGGCATTGTTCGTCATTTTGAAAAAGGCGACACCGGCC
ACCACTTTACCTACTACGGCTTAACCTTGGTTCCAGCATTGGAACGCTTATCTTTACGTCACAACAGCCG
TATCTTCCAAAAGCAAACCGCGCAAGACATCATCAGCCAACTGCTGAATGAAATGGGCATCACCGAACAC
TTGTTTGATACCCAACGTACACCGCTTGAACGTGAGTTCTGTGTCCAGTATCGTGAAAGTGACTTAGACT
TTGTCCACCGTTTGGCGGCCGAAGAAGGCTGGGTCTACTACTTCACCCACGAAGAAGGCAAACACCAACT
GCACTTTGCGGATCAAAGCCAACTACTGCCCAAACACCCAACCCCGATTCCGTACAACGTCTTATCGGGT
GGCGGCTCAGACGATCAATACATCGCCACCCTGACACACCGTACACAAAGCTTGCCTAGCCAAGCGGTGC
TCAAAGACTACAGCTTCAAAAAACCGGACTACCGCTTCTTGCACCAACAAGACGGCGAGAACCTAGACTA
CCAACTGCCAAACTACGAACACTACGATGCCCCTGGGCGCTTCAAAGACGACGTCACAGGCAAAGCCTTT
TCACGCATCCGTCTAGAATACCTACGCCGCAGTGCGCGAACCTTAGTAGGAGAAAGCAACCACGCCGCCA
TCCAAGCGGGCCTAAAAATCACCATCGAAGGCCACAGCGAAGACAGCATCAACCAAGAATGGTTGCCCGT
CTCGGTTGAACATCACGGCACCCAACCGCAAGTCTTGGAAGAAGAAGGCCAATCAGGCAGCACAAACTAC
AGCAATACATTTACCTTCATCCCCGCCACCACCAACTGGCAAGCGACACCGCAACCCAAACCCAGTGTCG
ATGGCCCCATGATGGCCATTGTGGTGGGGCCCGAAGGGGAAGAAATCTTCTGTGACGAACACGGACGAGT
CAAACTGCACTTCCCGTGGGACCGCTACAGCGAAGCCAACGACCATAGCTCCTGCTGGGTACGTGTCTCC
CAAGGCTGGGCTGGCAACCAACACGGCATGATGGCGATTCCACGAATCGGCAGCGAAGTCATTGTCAGCT
TTTTAAATGGCGACCCAGATCAACCGATCGTGACCGGACGCACCTTTAACGCCAAAAACACCCCGCCGTA
CCTTTTGCCTGACCATAAAACCAAAACCGTGTGGCGCAGCGATACTCACCAAGGCGAAGGCTTCAACGAG
ATCAGTTTTGAGGATCAAGTCGACAACGAAAAAGTCTATGTCCACGCGCAAAAAGACATGGAAACCGATG
TGCTCAACGACCGCATCACCCACATCGGCCACGACCAACACGGACAAATCGACAACGACCGCTTCACCCA
AATCGGTGGTGAAAACGGCACAGGCAATGACCACCTGACCATCAAAGGTGAAAGTCGTCATAAGATAGAT
AAAGACCAATCCATCAGTATTGATGGGAACTTACAGCAAAAGGTCGGAAAAATTGCCATATTAGAGGCAG
GTGAAGAAATACACATCAAGAGCGGTGACAAAACCGTGATTGAAGCAGGAGCAGAAATCACCCTTGCCGC
AGGCGGCAGCTTCGTCAAAATTGACGGCGGCGGTGTCCACCTAGTCGGCTCTGTTATCAACCTGAACTCT
GGCGGTAGCCCAAGTGCGGGTAGTGGGTTTTCAGGGAAGTTGCCTATATCTCCACTGGCTGAAGAACTGC
CTGTTTCTAATGAGAAAGTGGAAGAAAAAAGCGCGCCTCCGACTACACAGAAGTCCACACTTGTTATGGC
TGCTGAGGAAGGTAATCCAATATGTGAAGAGTGTCAGGCGGCAGCGAACACATAG
 Primer design

Protein ID: 152995218
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1189
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1326658..1327251 [+]
ProductVgrG protein
NoteTssI
UniProt IDA6VUI9
KEGG IDmmw:Mmwyl1_1189
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 2.10E-05, Aligned region: 72..114
Protein Sequence: 197 a.a.     [Download]
>gi|152995218|ref|YP_001340053.1| VgrG protein [Marinomonas sp. MWYL1]
METDVLNDRITHIGHDQHGQIDNDRLTQIGGDNGTGNDHLTIKGESRHKIDKDQSISIDGNLQQKVGKIA
VLEAGEEIHIKSGDKTVIEAGAEITLAAGGSFVKIDGGGVHLVGSVINLNSGGSPSAGSGFSGGEPLLPG
GILSPVAPEKSLMAPHSPSMKVTLPAVAELDLPVMELCQRQADGACTKANCTCIQDA
 
Nucleotide Sequence: 594 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1326658-1327251 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGAAACCGATGTGCTCAACGACCGCATCACCCACATCGGCCACGACCAACACGGACAAATCGACAACG
ACCGCCTCACCCAAATCGGCGGAGATAACGGCACAGGCAATGACCACCTGACCATCAAAGGCGAGAGTCG
TCACAAGATAGATAAAGATCAATCCATCAGTATTGATGGGAACTTACAGCAAAAGGTCGGAAAAATTGCC
GTATTAGAGGCAGGTGAAGAAATACACATCAAGAGTGGTGACAAAACCGTGATTGAAGCAGGAGCAGAAA
TCACCCTTGCCGCAGGCGGCAGCTTCGTCAAAATCGACGGCGGCGGTGTCCACCTCGTCGGCTCGGTTAT
CAACTTAAATTCTGGCGGTAGCCCAAGTGCGGGGAGTGGGTTTAGTGGGGGAGAGCCTCTCTTACCTGGT
GGTATCCTTTCTCCTGTCGCTCCAGAGAAGTCGCTTATGGCTCCACATAGCCCGAGCATGAAGGTAACGC
TTCCTGCTGTTGCTGAGTTGGATTTACCTGTTATGGAGCTTTGTCAGAGACAGGCTGATGGAGCCTGCAC
AAAAGCAAATTGTACATGTATTCAGGATGCATAA
 Primer design

Protein ID: 152995223
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1194
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1333278..1335245 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA6VUJ4
KEGG IDmmw:Mmwyl1_1194
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.60E-65, Aligned region: 43..336
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 375..467
DUF2345 [PF10106], Evalue: 0.0016, Aligned region: 579..624
Protein Sequence: 655 a.a.     [Download]
>gi|152995223|ref|YP_001340058.1| Rhs element Vgr protein [Marinomonas sp. MWYL1]
MATLTFTLALDGMEDNTLLVREYQGHESLSDSLLKDGSPCYGFRYQLALASRQSDLSADTIVDKNAELRV
FRNGELIQRVHGIVRHFEKGDTGHHFTYYGLTLVPALERLSLRHNSRIFQKQTAQDIISQLLNEMGITEH
LFDTQRTPLEREFCAQYRESDLDFVHRLAAEEGWVYYFTHEEGKHQLHFADQSQLLPKHPTPIPYNVLSG
GGSDDQYIATLTHHTQSLPSQAVLKDYSFKKPDYRFLHQQDGENLDYQLPNYEHYDAPGRFKDDVTGKAF
SRIRLEYLRRSARTLVGESNHAAIQAGLKITIEGHSEDSINQEWLPVSVEHHGTQPQVLEEEGQSGSTNY
SNTFTFIPATTNWQATPQPKPSVDGPMMAIVVGPEGEEIFCDEHGRVKLHFPWDRYSEANDHSSCWVRVS
QGWAGNQHGMMAIPRIGSEVIVSFLNGDPDQPIVTGRTFNAKNTPPYLLPDHKTKTVWRSDTHQGEGFNE
ISFEDQVDNEKVYVHAQKDMETDVLNDRITHIGHDQHGQIDNDRFTQIGGENGTGNDHLTIKGESRHKID
KDHTLMVDGSLQQKVGSKAVLDAAKEIHLKSGSKAVIEAGSEMTIKVGGNFIKIDAAGVHVVGSAINFNT
GGSASSGSGFSGVEPEPPVIDKATE
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|152994043|ref|NC_009654.1|:c1335245-1333278 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGCTACATTGACGTTTACACTGGCACTCGACGGCATGGAAGACAACACTCTGCTTGTCCGAGAATACC
AAGGGCACGAATCGCTCTCCGATTCCCTGCTAAAAGACGGCTCGCCTTGTTATGGCTTCCGTTACCAATT
GGCCCTCGCCAGCCGTCAATCGGATCTGTCTGCTGATACCATCGTCGATAAAAACGCCGAGTTACGCGTG
TTTCGTAATGGCGAACTGATTCAACGAGTGCACGGCATCGTTCGTCATTTTGAAAAAGGCGACACTGGAC
ACCACTTTACCTACTATGGCTTAACCTTGGTTCCGGCATTGGAGCGCTTATCTCTACGTCACAACAGCCG
TATCTTCCAAAAGCAAACCGCGCAAGACATCATCAGCCAACTGCTGAATGAAATGGGCATCACCGAACAC
CTGTTTGATACCCAACGTACACCGCTTGAACGTGAGTTCTGTGCTCAGTACCGTGAAAGTGACTTAGACT
TTGTCCACCGTTTGGCCGCCGAAGAAGGCTGGGTCTACTACTTCACCCACGAAGAAGGCAAACACCAACT
GCACTTTGCGGATCAAAGCCAACTACTGCCCAAACACCCAACGCCGATTCCGTACAACGTCTTATCGGGT
GGCGGCTCAGACGATCAATACATCGCCACCCTGACGCACCATACACAAAGCCTGCCTAGCCAAGCTGTGC
TCAAAGACTACAGCTTTAAAAAGCCCGATTACCGCTTCTTGCACCAACAAGACGGCGAGAACCTAGATTA
CCAGCTGCCAAACTACGAACACTACGATGCCCCTGGGCGCTTTAAAGACGACGTTACAGGCAAAGCCTTT
TCACGCATCCGTCTAGAATACCTACGTCGCAGTGCGCGCACCCTCGTAGGAGAAAGCAACCACGCCGCCA
TCCAAGCGGGCCTAAAAATCACCATCGAAGGCCACAGCGAAGACAGCATCAACCAAGAATGGTTGCCCGT
CTCGGTTGAACATCACGGCACCCAACCGCAAGTCTTGGAAGAAGAAGGCCAATCTGGCAGCACAAACTAC
AGCAATACATTTACCTTTATCCCCGCCACCACCAACTGGCAAGCGACACCGCAACCCAAACCCAGTGTCG
ATGGCCCCATGATGGCCATTGTGGTGGGGCCCGAAGGGGAAGAAATCTTCTGTGACGAACACGGACGAGT
CAAACTGCACTTCCCGTGGGACCGCTACAGCGAAGCCAACGACCATAGCTCCTGCTGGGTACGTGTCTCC
CAAGGCTGGGCGGGCAACCAACACGGCATGATGGCGATTCCACGAATCGGCAGCGAAGTCATTGTCAGCT
TTTTAAATGGCGACCCCGATCAACCGATCGTGACCGGACGTACCTTTAACGCCAAAAACACCCCGCCGTA
CCTTTTGCCTGACCATAAAACCAAAACCGTGTGGCGCAGCGATACTCACCAAGGCGAAGGCTTCAACGAG
ATCAGTTTTGAAGACCAAGTCGACAATGAAAAAGTCTACGTTCATGCGCAAAAAGACATGGAAACCGATG
TGCTCAACGACCGCATCACCCACATCGGTCACGACCAACACGGACAAATCGACAACGATAGATTCACGCA
AATTGGCGGTGAAAACGGCACAGGCAATGACCACCTGACCATCAAAGGCGAGAGTCGTCATAAGATCGAC
AAAGACCACACACTCATGGTGGACGGAAGTCTGCAACAGAAAGTCGGCTCGAAAGCCGTTCTGGATGCCG
CAAAAGAAATTCATCTAAAAAGTGGCAGTAAAGCCGTGATTGAGGCCGGATCAGAAATGACGATCAAAGT
CGGTGGCAACTTTATAAAAATCGACGCGGCTGGCGTACACGTTGTTGGCTCCGCCATCAACTTCAACACC
GGCGGCAGTGCCAGCTCTGGTAGTGGGTTTAGTGGTGTAGAACCTGAGCCACCAGTAATTGACAAAGCAA
CTGAGTAA
 Primer design

Protein ID: 152995241
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1212
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1357553..1359652 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA6VUL2
KEGG IDmmw:Mmwyl1_1212
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-64, Aligned region: 43..336
Phage_base_V [PF04717], Evalue: 1.70E-23, Aligned region: 375..467
DUF2345 [PF10106], Evalue: 0.0023, Aligned region: 579..623
Protein Sequence: 699 a.a.     [Download]
>gi|152995241|ref|YP_001340076.1| Rhs element Vgr protein [Marinomonas sp. MWYL1]
MATLTFTLALDGMEDNTLLVREYQGHESLSDSLLKDGSPCYGFRYQLALASRQSDLSADTIVDKNAELRV
FRNGELIQRVHGIVCHFEKGDTGHHFTYYGLTLVPALERLSLRHNSRIFQKQTAQDIISQLLNEMGITEH
LFDTQRTPLEREFCAQYRESDLDFVHRLAAEEGWVYYFTHEEGKHQLHFADQSQFLPKHPTPIPYNVLSG
GGSDDQYIATLTHHTQSLPSQAVLKDYSFKKPDYRFLHQEDGENLYYQLPNYEHYDAPGRFKDDVTGKAF
SRIRLEYLRRSARTLVGESNHAAIQAGLKITIEGHSEDSINQEWLPVSVEHHGTQPQVLEEEGQSGSTNY
HNRFTFIPATTNWQATPQPKPSVDGPMMAIVVGPEGEEIFCDEHGRIKLHFPWDRYSEANDHSSCWVRVS
QGWAGNQHGMMAIPRIGSEVIVSFLNGDPDQPIVTGRTFNAKNTPPYLLPDNKTKTVWRSDTHQGEGFNE
ISFEDQVDNEKVYIHAQKDMETDVLNDRITHIGHDQHGQIDNDRFTQIGGENGTGNDHLTIKGESRHKID
KDHTLMVDGSLQQKVGSKAVLDAGNEVHLSSGVKLVVDAGAELTLTAGGSFVKIDGSGVHLVGSAINLNS
GGSAGSGSGFGGAQAETPLNVVSPEYDANLEAPEGNEAPVVPVQQKQAIVTAAEQGTPICQACEEAATE
 
Nucleotide Sequence: 2100 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1357553-1359652 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGCTACATTGACGTTTACACTGGCACTCGACGGCATGGAAGACAACACTCTGCTTGTCCGAGAATACC
AAGGGCACGAATCGCTCTCCGATTCCCTGCTAAAAGACGGCTCGCCTTGTTATGGCTTCCGTTACCAATT
GGCCCTCGCCAGCCGTCAATCGGATCTGTCTGCTGATACCATCGTCGATAAAAACGCCGAGCTACGCGTG
TTTCGTAACGGCGAACTGATTCAACGAGTGCACGGCATTGTTTGCCACTTTGAAAAAGGCGACACCGGAC
ACCACTTTACCTACTATGGCTTAACCTTGGTTCCGGCATTGGAACGCTTATCGCTACGTCACAACAGCCG
TATCTTCCAAAAGCAAACCGCGCAAGACATCATCAGCCAATTGCTGAATGAAATGGGCATCACCGAACAC
CTGTTTGATACCCAACGTACACCGCTTGAGCGCGAGTTCTGTGCCCAGTACCGAGAAAGTGACTTAGATT
TTGTCCACCGTTTGGCGGCCGAAGAAGGCTGGGTCTACTACTTCACCCACGAAGAAGGCAAACACCAACT
GCACTTTGCAGATCAAAGCCAGTTTTTACCCAAACACCCAACCCCGATTCCGTACAACGTCTTATCAGGT
GGGGGCTCAGACGATCAATACATCGCCACCCTGACGCACCATACACAAAGCTTGCCTAGCCAAGCTGTGC
TCAAAGACTACAGCTTCAAAAAGCCCGACTACCGCTTCTTGCACCAAGAAGACGGCGAGAACCTATATTA
CCAGCTGCCAAACTACGAACACTACGATGCCCCTGGGCGTTTTAAAGACGACGTTACAGGCAAAGCCTTT
TCACGTATCCGTCTAGAATATCTACGTCGCAGTGCGCGAACCTTAGTAGGAGAAAGCAACCACGCCGCCA
TCCAAGCGGGCCTAAAAATCACCATCGAAGGCCACAGCGAAGACAGCATCAACCAAGAATGGCTGCCCGT
CTCGGTTGAACATCACGGCACCCAGCCGCAAGTCTTGGAAGAAGAAGGCCAATCTGGCAGCACAAACTAC
CACAACCGGTTTACCTTCATCCCAGCCACCACCAACTGGCAAGCGACACCGCAACCCAAACCCAGTGTCG
ATGGCCCCATGATGGCCATTGTAGTGGGACCCGAAGGGGAAGAAATCTTCTGTGATGAACACGGACGCAT
CAAACTGCACTTCCCATGGGACCGATACAGCGAAGCCAACGACCACAGCTCCTGCTGGGTACGTGTCTCC
CAAGGCTGGGCTGGCAACCAACATGGCATGATGGCGATCCCAAGAATCGGCAGCGAAGTCATCGTCAGCT
TTTTAAATGGCGACCCCGATCAACCGATCGTGACCGGACGTACCTTTAACGCCAAAAACACCCCGCCGTA
CCTTCTACCGGACAATAAAACCAAAACCGTCTGGCGCAGCGATACCCACCAGGGTGAAGGCTTCAACGAG
ATCAGCTTCGAAGACCAAGTCGACAACGAAAAAGTCTACATCCACGCGCAAAAAGACATGGAAACCGATG
TACTTAACGACCGCATCACCCACATCGGCCACGACCAACACGGACAAATCGACAACGACCGCTTCACCCA
AATCGGCGGAGAAAACGGCACAGGCAATGACCACCTGACCATCAAAGGCGAAAGTCGTCACAAGATAGAT
AAAGATCACACGCTGATGGTAGACGGAAGTCTGCAACAGAAAGTTGGCTCGAAAGCCGTACTGGATGCAG
GCAACGAAGTACATCTAAGCAGCGGTGTGAAACTGGTCGTTGATGCAGGCGCCGAACTCACCTTAACGGC
AGGGGGCAGCTTCGTAAAAATAGATGGCTCAGGCGTACACCTCGTCGGCTCGGCCATCAATCTAAACTCC
GGCGGCAGCGCAGGATCGGGCAGTGGCTTTGGCGGGGCACAAGCGGAAACACCGCTAAATGTGGTTTCAC
CTGAGTACGACGCTAACCTTGAAGCGCCTGAGGGGAATGAGGCACCGGTTGTTCCGGTTCAGCAAAAACA
AGCCATAGTCACCGCCGCAGAGCAGGGCACTCCTATTTGTCAGGCTTGTGAAGAGGCGGCAACAGAATGA
 Primer design