SecReT6
Protein ID: 152995218
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1189
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1326658..1327251 [+]
ProductVgrG protein
NoteTssI
UniProt IDA6VUI9
KEGG IDmmw:Mmwyl1_1189
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 2.10E-05, Aligned region: 72..114
Protein Sequence: 197 a.a.     [Download]
>gi|152995218|ref|YP_001340053.1| VgrG protein [Marinomonas sp. MWYL1]
METDVLNDRITHIGHDQHGQIDNDRLTQIGGDNGTGNDHLTIKGESRHKIDKDQSISIDGNLQQKVGKIA
VLEAGEEIHIKSGDKTVIEAGAEITLAAGGSFVKIDGGGVHLVGSVINLNSGGSPSAGSGFSGGEPLLPG
GILSPVAPEKSLMAPHSPSMKVTLPAVAELDLPVMELCQRQADGACTKANCTCIQDA
 
Nucleotide Sequence: 594 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1326658-1327251 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGAAACCGATGTGCTCAACGACCGCATCACCCACATCGGCCACGACCAACACGGACAAATCGACAACG
ACCGCCTCACCCAAATCGGCGGAGATAACGGCACAGGCAATGACCACCTGACCATCAAAGGCGAGAGTCG
TCACAAGATAGATAAAGATCAATCCATCAGTATTGATGGGAACTTACAGCAAAAGGTCGGAAAAATTGCC
GTATTAGAGGCAGGTGAAGAAATACACATCAAGAGTGGTGACAAAACCGTGATTGAAGCAGGAGCAGAAA
TCACCCTTGCCGCAGGCGGCAGCTTCGTCAAAATCGACGGCGGCGGTGTCCACCTCGTCGGCTCGGTTAT
CAACTTAAATTCTGGCGGTAGCCCAAGTGCGGGGAGTGGGTTTAGTGGGGGAGAGCCTCTCTTACCTGGT
GGTATCCTTTCTCCTGTCGCTCCAGAGAAGTCGCTTATGGCTCCACATAGCCCGAGCATGAAGGTAACGC
TTCCTGCTGTTGCTGAGTTGGATTTACCTGTTATGGAGCTTTGTCAGAGACAGGCTGATGGAGCCTGCAC
AAAAGCAAATTGTACATGTATTCAGGATGCATAA
 Primer design