SecReT6
Protein ID: 152995223
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1194
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1333278..1335245 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA6VUJ4
KEGG IDmmw:Mmwyl1_1194
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.60E-65, Aligned region: 43..336
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 375..467
DUF2345 [PF10106], Evalue: 0.0016, Aligned region: 579..624
Protein Sequence: 655 a.a.     [Download]
>gi|152995223|ref|YP_001340058.1| Rhs element Vgr protein [Marinomonas sp. MWYL1]
MATLTFTLALDGMEDNTLLVREYQGHESLSDSLLKDGSPCYGFRYQLALASRQSDLSADTIVDKNAELRV
FRNGELIQRVHGIVRHFEKGDTGHHFTYYGLTLVPALERLSLRHNSRIFQKQTAQDIISQLLNEMGITEH
LFDTQRTPLEREFCAQYRESDLDFVHRLAAEEGWVYYFTHEEGKHQLHFADQSQLLPKHPTPIPYNVLSG
GGSDDQYIATLTHHTQSLPSQAVLKDYSFKKPDYRFLHQQDGENLDYQLPNYEHYDAPGRFKDDVTGKAF
SRIRLEYLRRSARTLVGESNHAAIQAGLKITIEGHSEDSINQEWLPVSVEHHGTQPQVLEEEGQSGSTNY
SNTFTFIPATTNWQATPQPKPSVDGPMMAIVVGPEGEEIFCDEHGRVKLHFPWDRYSEANDHSSCWVRVS
QGWAGNQHGMMAIPRIGSEVIVSFLNGDPDQPIVTGRTFNAKNTPPYLLPDHKTKTVWRSDTHQGEGFNE
ISFEDQVDNEKVYVHAQKDMETDVLNDRITHIGHDQHGQIDNDRFTQIGGENGTGNDHLTIKGESRHKID
KDHTLMVDGSLQQKVGSKAVLDAAKEIHLKSGSKAVIEAGSEMTIKVGGNFIKIDAAGVHVVGSAINFNT
GGSASSGSGFSGVEPEPPVIDKATE
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|152994043|ref|NC_009654.1|:c1335245-1333278 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGCTACATTGACGTTTACACTGGCACTCGACGGCATGGAAGACAACACTCTGCTTGTCCGAGAATACC
AAGGGCACGAATCGCTCTCCGATTCCCTGCTAAAAGACGGCTCGCCTTGTTATGGCTTCCGTTACCAATT
GGCCCTCGCCAGCCGTCAATCGGATCTGTCTGCTGATACCATCGTCGATAAAAACGCCGAGTTACGCGTG
TTTCGTAATGGCGAACTGATTCAACGAGTGCACGGCATCGTTCGTCATTTTGAAAAAGGCGACACTGGAC
ACCACTTTACCTACTATGGCTTAACCTTGGTTCCGGCATTGGAGCGCTTATCTCTACGTCACAACAGCCG
TATCTTCCAAAAGCAAACCGCGCAAGACATCATCAGCCAACTGCTGAATGAAATGGGCATCACCGAACAC
CTGTTTGATACCCAACGTACACCGCTTGAACGTGAGTTCTGTGCTCAGTACCGTGAAAGTGACTTAGACT
TTGTCCACCGTTTGGCCGCCGAAGAAGGCTGGGTCTACTACTTCACCCACGAAGAAGGCAAACACCAACT
GCACTTTGCGGATCAAAGCCAACTACTGCCCAAACACCCAACGCCGATTCCGTACAACGTCTTATCGGGT
GGCGGCTCAGACGATCAATACATCGCCACCCTGACGCACCATACACAAAGCCTGCCTAGCCAAGCTGTGC
TCAAAGACTACAGCTTTAAAAAGCCCGATTACCGCTTCTTGCACCAACAAGACGGCGAGAACCTAGATTA
CCAGCTGCCAAACTACGAACACTACGATGCCCCTGGGCGCTTTAAAGACGACGTTACAGGCAAAGCCTTT
TCACGCATCCGTCTAGAATACCTACGTCGCAGTGCGCGCACCCTCGTAGGAGAAAGCAACCACGCCGCCA
TCCAAGCGGGCCTAAAAATCACCATCGAAGGCCACAGCGAAGACAGCATCAACCAAGAATGGTTGCCCGT
CTCGGTTGAACATCACGGCACCCAACCGCAAGTCTTGGAAGAAGAAGGCCAATCTGGCAGCACAAACTAC
AGCAATACATTTACCTTTATCCCCGCCACCACCAACTGGCAAGCGACACCGCAACCCAAACCCAGTGTCG
ATGGCCCCATGATGGCCATTGTGGTGGGGCCCGAAGGGGAAGAAATCTTCTGTGACGAACACGGACGAGT
CAAACTGCACTTCCCGTGGGACCGCTACAGCGAAGCCAACGACCATAGCTCCTGCTGGGTACGTGTCTCC
CAAGGCTGGGCGGGCAACCAACACGGCATGATGGCGATTCCACGAATCGGCAGCGAAGTCATTGTCAGCT
TTTTAAATGGCGACCCCGATCAACCGATCGTGACCGGACGTACCTTTAACGCCAAAAACACCCCGCCGTA
CCTTTTGCCTGACCATAAAACCAAAACCGTGTGGCGCAGCGATACTCACCAAGGCGAAGGCTTCAACGAG
ATCAGTTTTGAAGACCAAGTCGACAATGAAAAAGTCTACGTTCATGCGCAAAAAGACATGGAAACCGATG
TGCTCAACGACCGCATCACCCACATCGGTCACGACCAACACGGACAAATCGACAACGATAGATTCACGCA
AATTGGCGGTGAAAACGGCACAGGCAATGACCACCTGACCATCAAAGGCGAGAGTCGTCATAAGATCGAC
AAAGACCACACACTCATGGTGGACGGAAGTCTGCAACAGAAAGTCGGCTCGAAAGCCGTTCTGGATGCCG
CAAAAGAAATTCATCTAAAAAGTGGCAGTAAAGCCGTGATTGAGGCCGGATCAGAAATGACGATCAAAGT
CGGTGGCAACTTTATAAAAATCGACGCGGCTGGCGTACACGTTGTTGGCTCCGCCATCAACTTCAACACC
GGCGGCAGTGCCAGCTCTGGTAGTGGGTTTAGTGGTGTAGAACCTGAGCCACCAGTAATTGACAAAGCAA
CTGAGTAA
 Primer design