SecReT6
Protein ID: 152995224
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1195
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1335440..1335958 [-]
Producthypothetical protein
NoteTssD
UniProt IDA6VUJ5, A6VUJ5
KEGG IDmmw:Mmwyl1_1195
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-35, Aligned region: 8..155
Protein Sequence: 172 a.a.     [Download]
>gi|152995224|ref|YP_001340059.1| hypothetical protein Mmwyl1_1195 [Marinomonas sp. MWYL1]
MPTPCFISIEGESQGLITAGAMTVDSIGDVGLEGHDDEMLVQRFDHNVTVPTNPQSGNPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLPKVELKWYRTSAEGKQENFFVTELEGAVIVDIHCEMPHCQDPAMGNFTQ
NLTVSMAYRKITWDHINSGTSGSDDWSKPIEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|152994043|ref|NC_009654.1|:c1335958-1335440 Marinomonas sp. MWYL1 chromosome, complete genome
ATGCCAACGCCATGTTTTATCTCGATCGAAGGGGAATCTCAGGGTCTTATCACTGCTGGTGCCATGACAG
TCGATTCTATCGGTGACGTAGGCTTGGAAGGTCATGATGACGAAATGCTGGTGCAACGCTTTGACCACAA
CGTCACTGTACCGACTAACCCACAGTCTGGTAACCCATCTGGTCAACGCGTACACAAGCCATTCAAATTC
ACCGTTGCTTTGAACAAAGCGGTTCCATTGCTTTACAACGCACTGTCTTCTGGCGAAAAATTGCCAAAAG
TGGAATTGAAATGGTACCGCACGTCTGCAGAAGGCAAGCAAGAGAACTTCTTCGTTACCGAACTAGAAGG
CGCGGTCATCGTAGACATCCATTGCGAAATGCCACATTGCCAAGACCCAGCGATGGGCAACTTCACACAG
AACCTAACGGTCTCTATGGCTTACCGTAAGATCACTTGGGATCACATCAACTCTGGTACGTCTGGTTCTG
ACGACTGGAGCAAGCCAATCGAAGCGTAA
 Primer design