SecReT6
Protein ID: 152995225
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1196
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1336721..1337221 [+]
Producthypothetical protein
NoteTssB
UniProt IDA6VUJ6
KEGG IDmmw:Mmwyl1_1196
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.40E-57, Aligned region: 5..158
Protein Sequence: 166 a.a.     [Download]
>gi|152995225|ref|YP_001340060.1| hypothetical protein Mmwyl1_1196 [Marinomonas sp. MWYL1]
MSKEGSVAPKERINIKYIPATGDSQSEVELPLKTLVVGDFKGHAEDTPLEDRKSISIDKANFESVMRESN
LRLQTTVSNKLDEESDGDLTVDLSFSGINDFSPDSIASQVPELKKLIELREALVALKGPLGNIPSFRNSL
QGLLASDESRDQLLAELNLAHGNESN
 
Nucleotide Sequence: 501 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1336721-1337221 Marinomonas sp. MWYL1 chromosome, complete genome
ATGTCAAAAGAGGGAAGTGTCGCACCCAAAGAGCGGATAAATATTAAATATATACCTGCTACTGGAGATT
CTCAGTCTGAGGTTGAGTTGCCTCTAAAAACCTTGGTTGTTGGTGACTTTAAAGGTCATGCAGAGGATAC
GCCTTTAGAAGATAGAAAGAGCATTTCTATAGATAAAGCTAATTTTGAGTCTGTAATGCGTGAAAGTAAT
TTGCGTCTTCAGACGACAGTTAGTAATAAGCTAGATGAGGAGTCTGATGGTGATTTAACAGTAGATCTTT
CTTTTAGTGGGATTAATGATTTTTCACCAGATTCAATTGCATCGCAAGTTCCAGAGCTTAAAAAATTAAT
AGAGCTAAGAGAAGCTTTAGTAGCGTTAAAAGGTCCATTGGGTAATATCCCTTCTTTCAGAAATAGTTTG
CAAGGCTTGTTAGCATCAGATGAAAGTCGTGATCAGCTATTGGCTGAATTAAATCTAGCTCATGGGAATG
AGTCAAATTAA
 Primer design