SecReT6
Protein ID: 152995226
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1197
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1337275..1338756 [+]
Producthypothetical protein
NoteTssC
UniProt IDA6VUJ7
KEGG IDmmw:Mmwyl1_1197
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.40E-191, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|152995226|ref|YP_001340061.1| hypothetical protein Mmwyl1_1197 [Marinomonas sp. MWYL1]
MSTNDIAVEGSSVGQGRGNLLDEIMAQTRIAPNEEGYDVAKKGVAAFIENLLQSNKTEEPVNKTLVDQML
VELDRKISSQMNEILHDESFQQMESAWRGLKLLVDRTDFRENNKIELIHVTKSELLEDFEFAPETTQSGL
YKHVYSSGYGQFGGEPTGAIIGNYAFTPSSSDMKLLQYMGALGAMSHAPFISSVGPEFFGIESFEELPNL
KDLNSIFEGPKYAKWRTLRESEDARYIGLTAPRFLLRVPYDPIENPIKSFNYQEDVSKSHSDYLWGNTAF
AFASRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGELQAKIPTEVLVTDRKEFELAEEGFIALTM
RKGSDNAAFFSANSVQKPKVFPNTKDGKEAETNYRLSTQLPYMMIVNRLAHYVKVLQREQIGAWKERGDL
ERELNGWIKQYVADQENPPADVRSRRPLRGAKIEVSDVEGNPGWYQVSLAVRPHFKYMGANFELSLVGRL
DQA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1337275-1338756 Marinomonas sp. MWYL1 chromosome, complete genome
ATGTCTACAAATGATATTGCAGTCGAAGGAAGTTCGGTAGGTCAAGGGCGTGGAAATCTGCTTGACGAAA
TAATGGCCCAAACTCGCATAGCTCCGAATGAAGAGGGTTATGATGTTGCTAAAAAAGGTGTTGCGGCTTT
TATTGAGAATTTACTTCAATCAAATAAAACTGAGGAACCAGTTAATAAGACCTTAGTTGATCAAATGCTT
GTTGAATTAGATCGTAAAATCAGTAGTCAAATGAATGAAATACTACATGATGAATCTTTTCAGCAAATGG
AGTCTGCTTGGCGTGGGCTAAAACTGCTAGTCGATCGAACTGACTTTAGAGAAAACAATAAAATTGAGCT
AATTCATGTTACTAAGTCTGAATTGCTTGAAGATTTTGAGTTTGCTCCTGAAACCACACAGAGTGGCCTT
TATAAGCATGTTTACTCTTCTGGTTATGGTCAATTTGGTGGTGAGCCGACAGGTGCCATTATCGGTAATT
ATGCCTTCACTCCTTCCTCATCTGATATGAAGTTGCTTCAGTATATGGGAGCTTTAGGTGCGATGTCTCA
TGCGCCATTTATTTCAAGTGTTGGTCCTGAGTTTTTTGGTATTGAATCTTTTGAAGAGCTTCCAAACCTT
AAAGATCTGAACTCTATTTTTGAAGGGCCAAAATACGCAAAATGGCGCACTCTTCGTGAATCTGAAGATG
CTCGTTATATTGGTTTAACTGCACCACGTTTTTTATTACGTGTTCCGTATGACCCAATTGAAAATCCTAT
TAAATCTTTTAACTATCAGGAAGACGTGAGTAAGTCTCATAGTGATTACCTTTGGGGGAATACCGCTTTT
GCTTTTGCTTCACGTTTGACTGACAGTTTTGCTAAATACCGCTGGTGTCCAAATATTATTGGACCGCAAA
GTGGTGGTGCAGTAGAGGACTTGCCGGTTCATGTATTTGAGTCTATGGGTGAATTGCAAGCTAAAATTCC
TACAGAAGTATTGGTAACGGATAGAAAAGAGTTCGAATTAGCCGAAGAAGGCTTTATTGCTCTAACTATG
CGTAAAGGTAGTGATAACGCTGCTTTCTTCTCGGCGAACTCAGTACAAAAGCCGAAGGTATTTCCTAATA
CGAAAGACGGTAAGGAAGCGGAGACCAATTACCGCTTAAGTACTCAATTGCCTTACATGATGATTGTTAA
CCGTTTGGCGCATTACGTTAAAGTGCTTCAGCGTGAGCAAATTGGTGCGTGGAAAGAGCGTGGCGATCTA
GAGCGTGAATTGAATGGTTGGATCAAGCAATATGTTGCTGACCAAGAAAACCCACCTGCAGATGTTCGTA
GTCGTCGCCCACTTCGTGGCGCAAAAATTGAAGTATCCGATGTGGAAGGTAATCCAGGTTGGTATCAAGT
GTCTTTGGCAGTACGTCCTCATTTTAAATATATGGGTGCGAACTTCGAGCTGTCTCTTGTTGGCCGTTTA
GATCAAGCATAA
 Primer design