SecReT6
Protein ID: 152995227
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1198
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1338761..1339198 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA6VUJ8
KEGG IDmmw:Mmwyl1_1198
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.10E-17, Aligned region: 36..126
Protein Sequence: 145 a.a.     [Download]
>gi|152995227|ref|YP_001340062.1| GPW/gp25 family protein [Marinomonas sp. MWYL1]
MSYLIDENSVFGVSFMERLNVNAKAISLSQGPDSIDVLNSIKLNVANVLNTRLGEAQSAPNLGLIDFNDA
SLGAMDLSLKVKLAVQKCLATYEPRLCNLQIKTVTDPNNPLGLCFHINADINSAALHEKVEINLILGNDR
KYRVY
 
Nucleotide Sequence: 438 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1338761-1339198 Marinomonas sp. MWYL1 chromosome, complete genome
ATGAGCTACCTAATAGATGAAAATAGTGTTTTTGGCGTTAGCTTCATGGAACGATTGAATGTTAATGCTA
AGGCTATCTCTTTGTCTCAGGGGCCAGATTCTATAGATGTTCTTAACTCAATAAAGCTGAATGTAGCCAA
CGTTCTGAATACTAGATTGGGGGAGGCGCAATCCGCCCCTAATCTAGGATTGATAGATTTTAATGACGCT
TCGTTGGGCGCCATGGATCTATCTTTAAAAGTGAAGTTGGCTGTGCAGAAATGTTTAGCGACTTATGAGC
CTAGATTATGCAACTTACAAATCAAAACGGTTACAGATCCAAATAACCCTTTAGGTTTGTGTTTTCATAT
CAATGCTGACATCAATAGTGCTGCGCTTCATGAGAAAGTAGAGATTAATTTAATACTTGGTAATGACCGT
AAATATAGAGTGTATTAG
 Primer design