SecReT6
Protein ID: 152995228
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1199
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1339201..1340967 [+]
Producthypothetical protein
NoteTssF
UniProt IDA6VUJ9
KEGG IDmmw:Mmwyl1_1199
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-201, Aligned region: 5..588
Protein Sequence: 588 a.a.     [Download]
>gi|152995228|ref|YP_001340063.1| hypothetical protein Mmwyl1_1199 [Marinomonas sp. MWYL1]
MSQDKYFREELAFLREQGKQFTEIHPQLSRFLHGRNTDPDVERLLEGFAFLTGRLREKIEDEFPELTHSI
INMLWPNYLRPVPSMSVVKFKPEDNVSTKHVIQSGVQLDSRPVFGTTCHFRTCRDVSIYPLDCVDVSAQH
TREASTVNLAMKIDGDLTLDDIKLDTLRFYLGGDKFSAEMTYLWLNHYLEKIVIEVGGVEFKLPKDTLSL
VGFEAADSLLPYPKNVYDGYRILQEYLTFSESFNFFDLKGLSSALPKNISGEFTIKMVFNKTFEPGVKVR
KEMFQLYCTLVVNLFEHDADPIDLTGRKTEYRIIPSSTSPSHYEVFSIDEVAGWQNSSNGGRARGAKRVY
SSFESFQHEVERARHRESLYYRARVKDSIRNDGFDNFISFVRGDESSVYNFDEAVSLKLTCTNRQLPLEL
GIGDICEPTDTSPTFATFENITIPSPPLRPVLDGSLLWTLISNLSLNYLSLLSKDALCSVLRAYDFKALV
DRQAERVSRLRLSGILKIESMPTDKLIQGMPIRGLKSTITLDQAAFGSEGELFLFGTVLSKFFSLYASIN
SFHELVVINSSNKEAYTWGIQEGMQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1339201-1340967 Marinomonas sp. MWYL1 chromosome, complete genome
GTGAGCCAAGATAAGTATTTTAGAGAAGAGCTGGCGTTTTTACGTGAGCAAGGAAAGCAATTTACGGAAA
TTCATCCTCAGCTTTCTCGTTTCTTGCATGGGCGAAATACGGACCCTGATGTTGAGCGATTGTTAGAGGG
GTTTGCTTTTCTAACCGGGCGTTTAAGGGAAAAAATTGAAGATGAGTTCCCTGAGTTAACTCATTCAATC
ATTAATATGCTTTGGCCTAATTATCTGCGACCAGTGCCAAGTATGAGTGTTGTTAAGTTTAAGCCAGAGG
ATAACGTGAGCACTAAGCACGTTATTCAGTCTGGTGTTCAACTTGATAGTCGTCCAGTTTTTGGTACTAC
ATGTCATTTTAGAACCTGCCGCGACGTCTCTATTTACCCTTTAGATTGTGTAGACGTTTCTGCGCAACAT
ACAAGGGAGGCGAGTACCGTAAATCTTGCAATGAAAATTGACGGAGATTTAACGCTCGATGACATCAAGC
TCGATACATTAAGGTTCTATTTAGGTGGTGATAAATTCAGCGCTGAGATGACTTATTTATGGCTGAATCA
CTATTTAGAAAAAATTGTGATAGAGGTCGGTGGTGTTGAATTTAAACTGCCGAAAGATACTTTATCACTG
GTAGGTTTTGAAGCTGCCGATAGTTTGCTTCCGTACCCCAAAAATGTTTATGACGGCTATCGAATTCTTC
AGGAATATTTAACCTTTTCAGAAAGCTTCAACTTCTTTGATTTGAAAGGATTATCTAGTGCTTTACCTAA
AAATATTTCTGGTGAATTTACTATTAAAATGGTCTTCAACAAAACGTTCGAGCCTGGTGTAAAAGTTAGG
AAGGAAATGTTTCAGCTGTATTGTACACTGGTCGTTAATTTGTTTGAGCATGATGCAGACCCTATTGATC
TAACAGGGCGTAAAACAGAATACAGGATAATTCCATCCAGTACCTCACCGTCACATTATGAAGTCTTTAG
TATCGATGAGGTTGCTGGTTGGCAAAATAGCAGTAATGGTGGTCGTGCTAGAGGTGCGAAGCGTGTGTAT
TCCTCGTTTGAAAGTTTTCAGCATGAGGTGGAGCGTGCTAGACATCGTGAATCTCTTTATTACAGAGCTC
GTGTAAAAGACAGTATTAGAAATGATGGTTTTGATAACTTTATTTCTTTTGTCAGAGGTGACGAGTCGTC
TGTTTATAACTTTGATGAAGCTGTTTCTCTTAAGCTAACTTGTACCAATAGACAGTTGCCGCTTGAGCTT
GGTATTGGCGATATTTGTGAACCTACTGACACGTCTCCAACGTTCGCAACTTTTGAAAATATAACGATAC
CATCGCCTCCTTTAAGGCCTGTTTTAGATGGCAGCCTGCTTTGGACCTTGATTTCCAATTTATCATTAAA
TTATCTGTCATTGCTGTCTAAAGATGCTCTTTGCTCTGTATTGCGGGCTTATGATTTTAAGGCATTAGTA
GATCGTCAGGCTGAGCGCGTTTCTAGATTACGGTTGAGCGGCATCCTCAAAATAGAGTCGATGCCGACGG
ATAAATTGATCCAGGGAATGCCCATTCGGGGGTTGAAATCAACGATAACCTTAGATCAGGCTGCTTTTGG
TTCGGAAGGTGAATTATTTTTGTTTGGCACAGTGCTGAGTAAGTTTTTTTCTTTATACGCAAGTATCAAT
TCATTTCATGAATTGGTCGTAATTAACTCAAGCAATAAAGAGGCATATACGTGGGGAATTCAGGAAGGGA
TGCAACCACTGATATAG
 Primer design