SecReT6
Protein ID: 152995229
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1200
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1340931..1341944 [+]
Producthypothetical protein
NoteTssG
UniProt IDA6VUK0
KEGG IDmmw:Mmwyl1_1200
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.80E-91, Aligned region: 27..324
Protein Sequence: 337 a.a.     [Download]
>gi|152995229|ref|YP_001340064.1| hypothetical protein Mmwyl1_1200 [Marinomonas sp. MWYL1]
MGNSGRDATTDIESIASSSEPNIFPEDVEKFNFYQLVELLYRLIEQDPEESDWESKCQLVFSANPSLGFS
PTDVSSLKLLDDNRILLETNFFGLNGSQSPLPGFMLEQLVTEGEFGLKRQFLDFFNNRLISLVYQIWRKY
RYYIRFQGEAKDKFSSQLFALVGLADEGMRGETPINWCKMLAYSGTLAGRSRSPQVVEGIISHCFDLPEV
SIRQWIKRKVPIHQEQKLQLGMQNCGLGRETVLGDSVNDIKGKFAIEIKGLDKERFADFLPSGREFSPLC
KLVEFTLREQMAYDLELVLKDDEVSTMSLGNNSVSLGWTSFLGEPKEAKKVVIQVRQ
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1340931-1341944 Marinomonas sp. MWYL1 chromosome, complete genome
GTGGGGAATTCAGGAAGGGATGCAACCACTGATATAGAGAGTATCGCCTCTTCCAGTGAGCCAAATATAT
TTCCAGAAGATGTTGAAAAATTTAATTTTTATCAGCTTGTCGAGTTGTTGTATCGGCTTATAGAGCAAGA
TCCCGAAGAAAGCGATTGGGAATCGAAGTGTCAGTTGGTATTTAGTGCCAATCCAAGCTTAGGCTTTTCT
CCAACTGATGTTTCGTCGTTAAAGCTTCTGGATGATAACCGTATATTGCTTGAAACCAATTTTTTTGGCT
TGAATGGCTCTCAGTCGCCACTGCCGGGCTTTATGCTTGAGCAGTTGGTAACGGAAGGTGAGTTTGGTTT
AAAGCGTCAGTTTCTCGATTTTTTTAACAATCGTTTGATCTCGCTTGTTTACCAAATTTGGAGGAAGTAT
CGCTACTACATTCGTTTCCAAGGTGAAGCAAAGGACAAATTCTCAAGCCAATTGTTTGCCTTAGTGGGGT
TAGCTGATGAAGGGATGAGAGGCGAAACACCGATTAACTGGTGCAAAATGCTGGCTTATTCCGGCACTTT
AGCCGGGCGAAGCCGTTCTCCCCAAGTGGTTGAGGGGATTATTTCGCACTGTTTTGATCTGCCTGAAGTA
TCGATACGGCAATGGATTAAGCGCAAAGTGCCAATTCATCAAGAGCAAAAGCTGCAATTAGGGATGCAAA
ACTGTGGGCTAGGACGAGAAACTGTTTTGGGCGACAGTGTTAATGATATTAAAGGGAAGTTTGCTATAGA
AATTAAGGGTTTAGATAAAGAGCGATTTGCCGATTTTTTGCCAAGCGGTCGAGAATTTTCGCCTTTATGT
AAGCTAGTTGAGTTTACCTTGAGAGAACAGATGGCCTACGACCTTGAGTTAGTCTTAAAGGACGATGAAG
TATCTACTATGTCGTTAGGCAATAACAGTGTGTCTTTAGGCTGGACATCCTTTCTTGGTGAGCCAAAAGA
AGCGAAAAAAGTAGTCATACAGGTAAGACAATAG
 Primer design