SecReT6
Protein ID: 152995230
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1201
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1341947..1343458 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDA6VUK1
KEGG IDmmw:Mmwyl1_1201
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.60E-07, Aligned region: 35..102
Protein Sequence: 503 a.a.     [Download]
>gi|152995230|ref|YP_001340065.1| FHA domain-containing protein [Marinomonas sp. MWYL1]
MDNITQRVANFIVTNVRSLEAGLLAKMSFEDNGGVIGSALDADWHLKDRSQLIKPFHCEIVLVDDSFCVK
DLCGETYVNSSSMPLGVNKLARLNDEDEIKIGEYEIRVFLNRESELKETSHSLEQFFFTKSNSLIDGSDN
EKFDHDIDLEDICENVKELDPIVMLDSNKSLVDEENLIDEAPLVEVAEDFINSEFKYNSKISPKFTVQAD
TDNDITAAFGLNDIRRGGSLIEKESKTTKLKKFFSKSIFSSEKEEEKENGKQVMETQPMDDNVLDLLEQE
VAKSYTKEDTVKSSSQYKATYDNSSFENNHVLGGPLMSGLEVSIGSNSSVEEMQALSAEIGSTLRACVQG
LLDLHSQVKDSRYGMMHRSLQPIEDNPLKLGLSYEETIRTMFDENKSAVHLSATSSVEESLKMIRIHNEA
VQYATNIALGEILQALSPDALLKRFSRYNRDQKNSQDEKSWAWGMYENYYKELTSNRQQGFEKLFWEIFE
QSYDKKLREKHAE
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1341947-1343458 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGATAACATCACACAACGAGTCGCTAATTTTATTGTTACGAATGTACGGTCTCTTGAGGCTGGACTGT
TGGCGAAAATGTCTTTTGAAGATAACGGTGGGGTTATAGGTTCTGCTTTAGATGCAGATTGGCACCTTAA
AGACCGTAGTCAATTAATTAAACCTTTTCATTGTGAAATTGTTTTGGTGGATGACTCTTTTTGCGTAAAA
GACTTATGTGGCGAAACCTATGTTAATTCATCCAGCATGCCTTTAGGTGTTAATAAATTAGCTCGGCTCA
ATGATGAAGATGAAATCAAGATTGGTGAGTATGAGATACGAGTTTTTTTGAATAGAGAATCAGAGTTAAA
AGAAACCAGTCACTCACTTGAACAGTTTTTTTTTACTAAAAGTAATAGCTTGATTGATGGAAGTGATAAT
GAAAAATTTGATCATGATATTGATCTTGAAGATATTTGTGAAAATGTTAAAGAGCTAGATCCTATTGTTA
TGCTTGATAGTAATAAAAGCTTAGTTGATGAAGAGAATTTAATTGATGAAGCGCCTTTGGTCGAAGTGGC
TGAAGACTTTATTAATAGCGAATTTAAATACAATAGTAAAATATCACCAAAGTTTACTGTGCAGGCAGAT
ACGGATAATGATATCACCGCTGCTTTTGGTTTAAATGATATACGACGTGGTGGCTCCTTAATAGAAAAGG
AAAGTAAAACTACGAAACTGAAGAAATTTTTTTCTAAATCTATTTTTTCTAGTGAAAAAGAGGAAGAGAA
AGAAAACGGCAAACAAGTAATGGAGACCCAGCCAATGGACGATAATGTTTTAGACCTGCTTGAGCAGGAA
GTAGCAAAGTCTTATACAAAAGAAGATACGGTAAAGTCGAGCTCTCAATACAAAGCAACCTATGATAATA
GCTCCTTTGAGAATAATCATGTGCTTGGTGGGCCTTTAATGTCTGGGCTGGAGGTATCGATTGGAAGTAA
CTCTAGTGTAGAAGAAATGCAAGCATTATCGGCAGAGATAGGAAGCACCTTGCGTGCTTGCGTTCAAGGC
TTGTTAGATTTGCATTCCCAAGTGAAAGACAGTCGCTATGGCATGATGCACAGAAGCCTTCAGCCTATTG
AAGATAACCCACTTAAGCTTGGCCTTTCCTACGAAGAAACGATTCGAACCATGTTCGATGAAAACAAAAG
TGCAGTGCATCTTTCAGCTACATCTTCCGTTGAAGAAAGCCTGAAGATGATAAGAATTCATAATGAAGCA
GTGCAATATGCAACCAATATCGCACTTGGTGAGATTTTGCAGGCTTTATCTCCAGACGCATTATTAAAGC
GCTTTAGTCGTTATAACCGAGACCAAAAAAATAGTCAGGATGAAAAGTCTTGGGCATGGGGAATGTACGA
GAATTATTACAAGGAATTAACTTCAAATCGCCAGCAAGGGTTTGAGAAACTATTTTGGGAAATATTCGAG
CAGTCTTATGATAAAAAATTGCGTGAGAAACATGCAGAGTAG
 Primer design