SecReT6
Protein ID: 152995231
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1202
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1343448..1343939 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA6VUK2
KEGG IDmmw:Mmwyl1_1202
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-36, Aligned region: 16..156
Protein Sequence: 163 a.a.     [Download]
>gi|152995231|ref|YP_001340066.1| hypothetical protein Mmwyl1_1202 [Marinomonas sp. MWYL1]
MQSSQLLKLLTPFLLMVFLAGCSTSQKVKPEDRITRVTFSLFAGEKVNAGESGTPAPVEIQVYELVDDSM
LMSADFDMINKDYEKALKNNFVKTYDYVLTPGQFKFVGDFEIDEETNYIGVVAKFAEPDKSDWKKAVKIL
NRGRIYHLLMYFDGYEIKLERVE
 
Nucleotide Sequence: 492 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1343448-1343939 Marinomonas sp. MWYL1 chromosome, complete genome
ATGCAGAGTAGCCAGTTATTAAAGCTACTAACGCCTTTTTTACTTATGGTGTTTTTGGCGGGGTGTAGCA
CTTCCCAAAAAGTTAAACCTGAAGATCGGATAACAAGAGTGACTTTTAGCTTGTTTGCGGGTGAGAAGGT
AAATGCGGGTGAATCTGGAACGCCAGCACCAGTAGAAATTCAAGTATATGAATTGGTTGATGATTCAATG
CTTATGTCTGCTGACTTTGATATGATAAATAAGGACTATGAGAAAGCACTGAAGAATAACTTTGTCAAAA
CTTATGATTATGTTTTAACTCCTGGGCAATTCAAATTTGTCGGTGATTTTGAAATAGACGAAGAAACAAA
TTATATCGGTGTAGTGGCTAAATTTGCTGAGCCAGATAAAAGTGATTGGAAAAAAGCGGTTAAAATTCTA
AACCGTGGAAGGATATATCATTTATTGATGTATTTTGATGGTTATGAAATTAAATTGGAAAGGGTTGAGT
AG
 Primer design