SecReT6
Protein ID: 152995232
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1203
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1343942..1345276 [+]
Producthypothetical protein
NoteTssK
UniProt IDA6VUK3
KEGG IDmmw:Mmwyl1_1203
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.30E-160, Aligned region: 19..443
GMP_synt_C [PF00958], Evalue: 0.0063, Aligned region: 65..233
GMP_synt_C [PF00958], Evalue: 0.0063, Aligned region: 305..374
Protein Sequence: 444 a.a.     [Download]
>gi|152995232|ref|YP_001340067.1| hypothetical protein Mmwyl1_1203 [Marinomonas sp. MWYL1]
MISRNRVIWNEGLFIKPQHFQQQQRYNEYSLNERVQSVSSYLYGISHLSINPEYLSFGRIAIDSAVGVMP
DGTVFRIPQDDMLPDALDIDDATLTGQTIYLAIPLKNESLLEIDWPNEKGTGRYASHRQEVKDTQSVDGD
TAVIDLASMRLKLMFEKEDRSAYASIAIAQIREKRQDGSIVLEPDFIPCHLDVNCNPQLHRCINELSGLM
KERAKGIAVRLGASGQGAIADVSDFMLLQALNRLQPILQHLVHLKRLHPERLYEALASICGELSTFTDES
RLSPDFKGYNHDLPSDSFWQVIRYLRQSLSVVLEPRAVSVQLHQRKYGLMVAPIHDTQLIDNADFILAVK
ANMPLDELRNLFIQQTKVSSVEKIRDLISHQLPGIPVLPLPVAPRQLPYFSGYTYYQLDKTSEAWRMLEN
SSGFAFHVAGAFEGLDLQFWAIRD
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1343942-1345276 Marinomonas sp. MWYL1 chromosome, complete genome
ATGATTTCTAGGAATAGAGTTATTTGGAATGAAGGACTATTTATTAAGCCCCAACATTTTCAGCAACAGC
AAAGGTACAACGAGTACTCTTTAAATGAAAGAGTGCAATCTGTTAGTAGCTATTTATATGGGATATCCCA
TTTATCTATTAATCCAGAATATTTATCTTTTGGACGAATAGCGATTGATAGTGCTGTTGGTGTAATGCCT
GATGGTACGGTATTTCGTATTCCTCAGGACGACATGCTTCCAGATGCTTTGGATATTGATGATGCAACTT
TAACAGGTCAAACGATATATTTGGCAATACCGTTAAAAAATGAATCCTTGTTAGAAATTGACTGGCCTAA
TGAAAAAGGCACAGGACGATATGCTAGCCATCGTCAAGAAGTAAAAGATACTCAGTCTGTAGATGGCGAT
ACCGCTGTTATAGACTTAGCTTCTATGCGTCTTAAATTGATGTTTGAAAAAGAGGATCGTAGTGCTTACG
CCTCTATTGCTATCGCCCAAATCCGAGAGAAGCGTCAGGACGGTAGTATTGTTTTGGAACCTGATTTCAT
ACCTTGCCACCTAGATGTTAACTGTAATCCTCAGTTACATCGTTGTATTAACGAGTTATCAGGTTTAATG
AAAGAGCGTGCGAAAGGTATTGCGGTTCGTTTGGGAGCATCAGGCCAAGGTGCTATTGCTGATGTTTCTG
ATTTTATGTTGCTTCAAGCGTTAAATAGATTACAGCCAATTCTTCAGCATCTTGTTCACTTAAAACGCTT
GCATCCAGAACGTTTATATGAAGCGCTAGCGTCTATTTGTGGTGAGTTATCAACATTTACTGATGAAAGT
CGCTTGTCTCCTGATTTTAAAGGCTATAACCATGACTTACCAAGCGATTCTTTTTGGCAAGTGATTCGCT
ATCTGCGTCAGAGCTTAAGTGTGGTTCTTGAACCAAGAGCGGTTTCGGTTCAATTGCATCAACGTAAGTA
CGGCCTAATGGTTGCACCAATTCATGATACTCAGTTAATTGATAATGCAGACTTTATCTTAGCGGTTAAG
GCGAATATGCCATTGGATGAATTGAGAAATCTATTTATCCAGCAAACAAAAGTGTCTTCAGTAGAAAAGA
TCAGAGATCTTATTTCACATCAATTACCTGGTATACCTGTTTTGCCTTTACCTGTAGCACCAAGACAGTT
GCCATATTTCTCTGGTTATACCTATTACCAATTAGATAAAACAAGTGAGGCTTGGAGAATGTTAGAAAAT
TCTTCTGGTTTTGCTTTCCATGTCGCAGGGGCGTTTGAAGGTTTAGATTTACAATTTTGGGCGATAAGGG
ATTAA
 Primer design