SecReT6
Protein ID: 152995233
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1204
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1345279..1346055 [+]
Producthypothetical protein
NoteTssL
UniProt IDA6VUK4
KEGG IDmmw:Mmwyl1_1204
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.40E-64, Aligned region: 37..242
Protein Sequence: 258 a.a.     [Download]
>gi|152995233|ref|YP_001340068.1| hypothetical protein Mmwyl1_1204 [Marinomonas sp. MWYL1]
MASNGIIGKYDDLLFDEAENINDDKDYWFQIKGHNDNPLIDSATTFFGLSLRVKSLSECENIEEIYRQTI
EEINIIEIELADKHYEHSVLMAYRYILCAFLDEAVMGTRWGGSSAWAEYSMLSRFHNETWGGEKVFSILS
RLEKDPEKYKDLLEFIYYCLVLGFEGKFKVLNNGKEEREKVISKLHSLLDSMDEKESLKLTSKNDHVVNT
RYKLSKQLPVWSVFAFFAAFWGLTFCGYLFLLNSKSSNVLMQLNQILQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1345279-1346055 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGCTAGTAATGGCATTATTGGTAAATATGATGATTTGCTTTTTGATGAAGCAGAAAACATAAATGATG
ACAAGGATTACTGGTTTCAAATAAAAGGCCACAATGATAATCCTTTAATTGACTCTGCGACGACTTTCTT
TGGCTTATCTTTAAGGGTTAAGTCTTTAAGTGAGTGTGAAAATATTGAAGAAATATACAGGCAGACTATC
GAAGAAATTAACATTATCGAAATAGAACTTGCTGATAAGCATTATGAGCATTCTGTGCTGATGGCATATC
GCTATATCTTGTGTGCTTTTTTGGATGAAGCCGTCATGGGAACTCGATGGGGTGGCTCATCTGCATGGGC
TGAATACTCTATGCTATCTCGTTTCCACAATGAAACATGGGGTGGAGAGAAAGTATTTTCAATTTTATCT
AGGTTGGAAAAAGACCCTGAAAAATATAAGGATCTGCTGGAATTTATTTATTACTGTTTGGTTTTAGGCT
TTGAAGGGAAGTTTAAAGTTTTAAATAATGGTAAAGAAGAAAGGGAAAAGGTTATTAGTAAACTGCATTC
ACTTTTAGATTCAATGGATGAAAAAGAATCTTTAAAGCTGACTTCTAAAAATGATCATGTAGTAAATACC
CGTTACAAGTTAAGCAAACAGTTGCCTGTTTGGTCTGTTTTTGCATTTTTTGCTGCTTTTTGGGGATTAA
CTTTTTGCGGTTATTTATTTTTATTGAACAGCAAATCTTCAAATGTACTTATGCAGCTTAATCAAATACT
GCAGTAA
 Primer design