SecReT6
Protein ID: 152995234
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1205
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1346109..1348730 [+]
ProductATPase
NoteTssH
UniProt IDA6VUK5
KEGG IDmmw:Mmwyl1_1205
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.80E-38, Aligned region: 611..772
AAA [PF00004], Evalue: 3.40E-19, Aligned region: 223..354
AAA [PF00004], Evalue: 3.40E-19, Aligned region: 617..739
ClpB_D2-small [PF10431], Evalue: 1.70E-14, Aligned region: 778..852
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 223..243
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 296..353
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 476..528
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 616..733
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 79..119
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 200..240
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 264..301
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 489..546
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 587..655
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 682..710
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 803..851
AAA_22 [PF13401], Evalue: 4.80E-09, Aligned region: 222..315
AAA_22 [PF13401], Evalue: 4.80E-09, Aligned region: 340..379
AAA_22 [PF13401], Evalue: 4.80E-09, Aligned region: 511..531
AAA_22 [PF13401], Evalue: 4.80E-09, Aligned region: 613..643
AAA_25 [PF13481], Evalue: 4.40E-06, Aligned region: 223..286
AAA_25 [PF13481], Evalue: 4.40E-06, Aligned region: 611..649
Clp_N [PF02861], Evalue: 9.40E-06, Aligned region: 24..73
AAA_17 [PF13207], Evalue: 6.00E-05, Aligned region: 223..271
AAA_17 [PF13207], Evalue: 6.00E-05, Aligned region: 502..519
AAA_17 [PF13207], Evalue: 6.00E-05, Aligned region: 617..651
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 203..237
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 616..656
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 682..703
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 220..244
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 613..638
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 39..62
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 223..325
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 615..698
NACHT [PF05729], Evalue: 0.00017, Aligned region: 21..99
NACHT [PF05729], Evalue: 0.00017, Aligned region: 223..250
NACHT [PF05729], Evalue: 0.00017, Aligned region: 482..532
NACHT [PF05729], Evalue: 0.00017, Aligned region: 617..645
DUF258 [PF03193], Evalue: 0.00026, Aligned region: 199..240
DUF258 [PF03193], Evalue: 0.00026, Aligned region: 616..657
Zeta_toxin [PF06414], Evalue: 0.00026, Aligned region: 131..166
Zeta_toxin [PF06414], Evalue: 0.00026, Aligned region: 223..242
Zeta_toxin [PF06414], Evalue: 0.00026, Aligned region: 518..538
Zeta_toxin [PF06414], Evalue: 0.00026, Aligned region: 606..656
AAA_29 [PF13555], Evalue: 0.00049, Aligned region: 215..241
AAA_29 [PF13555], Evalue: 0.00049, Aligned region: 612..627
AAA_18 [PF13238], Evalue: 0.0017, Aligned region: 223..249
AAA_18 [PF13238], Evalue: 0.0017, Aligned region: 617..649
Sigma54_activat [PF00158], Evalue: 0.002, Aligned region: 221..238
Sigma54_activat [PF00158], Evalue: 0.002, Aligned region: 615..714
DUF815 [PF05673], Evalue: 0.0026, Aligned region: 219..267
DUF815 [PF05673], Evalue: 0.0026, Aligned region: 609..650
RNA_helicase [PF00910], Evalue: 0.0032, Aligned region: 224..244
RNA_helicase [PF00910], Evalue: 0.0032, Aligned region: 617..639
IstB_IS21 [PF01695], Evalue: 0.0037, Aligned region: 217..247
IstB_IS21 [PF01695], Evalue: 0.0037, Aligned region: 615..633
Protein Sequence: 873 a.a.     [Download]
>gi|152995234|ref|YP_001340069.1| ATPase [Marinomonas sp. MWYL1]
MIRIELSTLISKLNSQSKLALEQAAALCIERQHHEVSIEHFLSVLLENPMSDVCVIFDHVKLGKDDIQAA
ISKSYPRSTTLDTYPPFSPLLVELMQEAWLLSSTELNQTELRSGAILLASLIHPDRYYSFEMIGLFEKIN
KEAIRKNFDLVLERSSESDHVVSDSQDKSTSSSVAAGNSALGKFCTNVTLQAKNDELDPVLCREDELNLM
VDILCRRRKNNPIVVGEAGVGKSAVVEGLALRIVAGNVPDKLANVEIHSLDLGLLQAGASIKGEFEKRLK
GIIDEIKSSPVPIILFIDEAHTLIGSGNQEGGSDAANLLKPALARGELSTIAATTWKEYKKYFEKDPALT
RRFQLVKVEEPSVSQSVDIMRGLHHVYEKAHGVLIHDDALKASSELSARYLSGRQLPDKAIDVLDTACAR
IAINISTPPKVLGQLENQCCTRQREIDMLKRQALIGQPVDNDYLESLIELEVQAELEKETLLNSWSKQKE
IIEKIIDIRQSILRNPVADDEALSDDELDELREQLAASYQELEQIPHHERLMYPEVNAQQIAEVISDWTG
VPIDQMNSDELHKITHLPEILNAKIKGQDVAIECVHRHLLTSRADLRRPGRPKGAFLLVGPSGVGKTETV
IQLAEELYGGKQFLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRKKPYSVVLLDEVEKAHPE
VLNLFYQAFDKGELADGEGRLIDCQNILFFLTSNLGYQTIVDNVETPKEIEAKLYPELVPFFKPALLARM
EIVPYLPLNKDVLEKIVLGKLSSLEKLLRKRYSAEVEIDPALVQEILNRATRSENGARMLEAIIEGQVLP
PISLALLNRLAEQQPVSRIFMTIEEGEFVGEIE
 
Nucleotide Sequence: 2622 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1346109-1348730 Marinomonas sp. MWYL1 chromosome, complete genome
GTGATTAGAATTGAACTTTCCACACTGATTTCTAAATTAAACTCCCAGAGCAAATTGGCTTTGGAGCAAG
CTGCCGCATTATGTATTGAACGACAGCATCATGAAGTCAGTATTGAACACTTTTTAAGCGTTTTACTTGA
AAACCCTATGTCTGATGTGTGTGTGATTTTTGATCATGTTAAATTGGGCAAGGATGATATTCAGGCTGCA
ATCTCTAAAAGTTACCCAAGATCAACAACACTCGATACTTACCCGCCATTTTCTCCGTTATTAGTCGAGC
TGATGCAGGAGGCGTGGTTGTTATCTTCAACTGAGCTAAATCAAACTGAATTACGATCTGGTGCTATTTT
ACTTGCATCCCTTATTCATCCTGATCGTTATTATTCTTTTGAAATGATTGGCCTTTTTGAAAAAATTAAC
AAAGAAGCCATTCGTAAGAACTTTGATCTTGTGCTTGAGCGTTCTTCCGAGTCAGATCATGTTGTAAGCG
ACTCTCAAGATAAATCCACTTCGTCTTCCGTGGCTGCGGGTAACTCTGCATTGGGTAAATTTTGTACCAA
TGTGACCTTGCAAGCGAAGAATGATGAGCTTGATCCTGTGCTTTGTCGTGAAGATGAATTGAATCTTATG
GTCGATATTCTTTGTCGTCGTAGAAAGAATAATCCTATTGTTGTGGGTGAAGCAGGGGTTGGTAAAAGCG
CTGTTGTAGAAGGCCTTGCACTTAGAATTGTTGCTGGGAATGTGCCAGATAAGCTTGCTAATGTAGAAAT
CCACTCTCTGGATTTAGGTCTTTTGCAAGCTGGTGCGTCGATTAAAGGGGAGTTTGAAAAACGTCTCAAG
GGCATTATTGATGAGATTAAATCCTCACCTGTTCCGATTATTTTGTTTATCGATGAAGCACACACTCTGA
TTGGTTCTGGTAATCAAGAAGGTGGTAGTGATGCTGCCAACCTATTAAAGCCAGCTTTGGCGCGTGGTGA
ATTGTCTACCATTGCGGCAACGACTTGGAAAGAATACAAAAAATACTTTGAGAAAGATCCTGCGCTAACA
AGACGTTTCCAACTGGTTAAAGTGGAAGAACCGTCTGTTAGTCAATCTGTTGATATCATGCGTGGCTTAC
ACCATGTCTATGAAAAAGCGCACGGCGTTTTAATTCATGATGATGCGTTGAAAGCGTCCTCTGAATTATC
GGCTCGCTATTTGTCAGGTCGCCAGCTTCCTGATAAAGCCATAGATGTACTGGATACGGCTTGCGCTCGT
ATTGCTATCAATATATCGACACCGCCAAAAGTATTGGGGCAGTTAGAAAATCAATGTTGTACGCGCCAGC
GTGAAATAGACATGTTGAAGCGACAAGCATTGATTGGCCAGCCTGTTGATAACGACTATCTAGAAAGTTT
GATTGAATTGGAAGTTCAAGCAGAATTAGAAAAAGAAACTCTGCTAAACAGCTGGTCAAAGCAGAAAGAG
ATAATTGAAAAAATTATCGATATCCGCCAATCCATTTTACGCAATCCAGTGGCTGACGATGAAGCCTTGA
GTGATGATGAGCTAGATGAACTTCGCGAGCAGCTAGCCGCTAGCTATCAGGAACTTGAGCAGATCCCTCA
TCATGAACGTTTGATGTACCCAGAAGTAAATGCACAACAAATAGCTGAAGTGATTTCTGATTGGACTGGT
GTGCCGATTGATCAAATGAACTCTGATGAACTGCATAAAATCACGCACTTGCCTGAAATCTTAAACGCTA
AGATTAAAGGCCAGGATGTGGCCATTGAGTGTGTTCATAGGCACTTACTGACATCAAGAGCAGACCTTAG
ACGCCCAGGTCGTCCGAAAGGCGCTTTCTTGTTGGTTGGTCCAAGTGGTGTGGGTAAAACGGAAACAGTT
ATTCAATTGGCAGAAGAGCTGTACGGCGGAAAGCAATTCCTAACCACCATCAACATGTCTGAGTATCAAG
AGAAGCACACGGTTTCGCGACTAATTGGTTCTCCACCAGGTTATGTGGGCTTTGGTGAAGGCGGTGTACT
GACAGAAGCTATTCGTAAGAAACCATACTCTGTTGTGCTTCTGGATGAAGTAGAAAAAGCACACCCAGAG
GTGTTGAACTTGTTCTATCAGGCCTTTGATAAAGGCGAATTGGCTGATGGAGAAGGTCGCTTAATCGACT
GTCAAAATATTCTCTTTTTCCTAACGTCTAACCTTGGTTATCAAACTATCGTCGACAACGTAGAGACACC
AAAAGAGATTGAAGCCAAGCTTTATCCTGAGCTGGTGCCATTCTTTAAACCCGCTTTGTTAGCTCGTATG
GAAATCGTGCCATATTTGCCACTCAATAAAGACGTGTTAGAGAAGATAGTGCTGGGCAAATTATCTTCCC
TAGAAAAATTGTTACGCAAACGTTACTCCGCTGAAGTAGAAATTGATCCGGCATTGGTTCAAGAGATTTT
GAACCGTGCCACACGATCAGAGAATGGTGCCCGAATGTTAGAAGCCATAATAGAGGGACAAGTATTACCA
CCTATTTCTCTTGCGCTTCTTAATCGACTGGCCGAGCAACAACCAGTATCCCGAATCTTCATGACCATTG
AAGAAGGGGAGTTCGTAGGTGAGATCGAATAG
 Primer design