SecReT6
Protein ID: 152995235
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1206
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1348733..1350283 [+]
Productsigma-54 dependent trancsriptional regulator
NoteVasH
UniProt IDA6VUK6
KEGG IDmmw:Mmwyl1_1206
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 2.00E-67, Aligned region: 194..360
Sigma54_activ_2 [PF14532], Evalue: 6.60E-23, Aligned region: 162..177
Sigma54_activ_2 [PF14532], Evalue: 6.60E-23, Aligned region: 195..365
AAA_5 [PF07728], Evalue: 6.70E-07, Aligned region: 218..346
Mg_chelatase [PF01078], Evalue: 4.90E-05, Aligned region: 204..334
AAA [PF00004], Evalue: 0.00035, Aligned region: 188..215
AAA [PF00004], Evalue: 0.00035, Aligned region: 218..345
HTH_8 [PF02954], Evalue: 0.0028, Aligned region: 348..358
HTH_8 [PF02954], Evalue: 0.0028, Aligned region: 470..506
AAA_2 [PF07724], Evalue: 0.0055, Aligned region: 216..311
AAA_2 [PF07724], Evalue: 0.0055, Aligned region: 414..446
Protein Sequence: 516 a.a.     [Download]
>gi|152995235|ref|YP_001340070.1| sigma-54 dependent trancsriptional regulator [Marinomonas sp. MWYL1]
MNNWLKSAAELVVIRSTAQLLSTFTQVLDSELGCRGVYVLTPSADGRFVESSMNDSRQLSWSVSDFDNPF
AHVIHSGKVMILRNSELLYWLTNDSFADLIGCTDETVNVIILPMLSKDGQLQAILVLKTDSYSNYDVDSD
ENFLGLLSVCANHLQLLNDMEAKKRKSQLLSESLIEVEQGKKKNHLLDGLANVLIGQSDVMKSLREQVTI
AASSRLSVMIQGETGTGKELVSRAVHDLSSRSKANFVAINCAAIPEHLLESELFGYVKGAFSGADKSKKG
LLADADGGTLFLDEIGDMPLALQAKLLRVLESHKYRPVGSEKELDSNFRLVVATHLNLKQQVLDNKFRKD
LYYRLYQYPITLPRLKDRKSDIEKLSAHFVEQYNAKHKSSVRGLHYKAMDCLLDYDFPGNVRELKHLIEY
GAAQTQNGEQIELAYIQLKLDSEMASSSQPEPKNRALVELSTIRDLKVAVREYESNIIAARLREFDGDRG
RTAESLGIPKRTLADKCLKLEISIND
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1348733-1350283 Marinomonas sp. MWYL1 chromosome, complete genome
ATGAATAACTGGCTTAAGTCTGCAGCTGAGTTGGTGGTGATTCGTAGCACCGCTCAGTTGTTGTCAACAT
TCACGCAAGTACTTGATAGCGAGCTAGGGTGCCGAGGGGTTTATGTCCTAACCCCTTCTGCTGATGGGCG
CTTTGTAGAATCGAGCATGAATGATAGTCGTCAATTATCTTGGTCGGTTTCTGACTTTGATAATCCATTT
GCCCACGTCATTCATTCAGGCAAAGTCATGATACTGCGTAACAGCGAATTGCTTTACTGGTTAACGAATG
ACAGTTTTGCTGATCTGATTGGTTGTACTGATGAAACCGTAAACGTCATCATTTTGCCCATGTTGTCAAA
AGATGGGCAGCTTCAGGCGATCTTGGTTTTAAAAACGGATAGTTACTCGAATTATGATGTGGACAGCGAT
GAAAATTTTTTAGGTCTGCTGTCTGTTTGTGCGAATCATTTACAGTTACTTAATGATATGGAAGCAAAGA
AAAGGAAGTCACAACTGCTGTCAGAGTCATTGATAGAAGTGGAACAAGGTAAGAAAAAGAACCATCTCTT
GGATGGACTTGCCAACGTATTAATTGGTCAAAGTGACGTAATGAAATCGCTGCGTGAACAGGTGACCATT
GCTGCATCATCCCGTCTTTCAGTGATGATTCAAGGAGAGACAGGTACGGGGAAGGAGTTAGTGTCGCGTG
CTGTCCATGATTTGTCCTCACGTAGTAAAGCAAATTTTGTCGCTATAAATTGTGCTGCTATCCCTGAGCA
TTTGCTGGAAAGCGAGTTGTTTGGCTACGTCAAAGGCGCATTTTCCGGTGCAGATAAAAGTAAAAAAGGG
CTGTTAGCCGATGCGGACGGGGGCACTCTATTCCTGGATGAAATCGGAGATATGCCGTTAGCTTTGCAAG
CGAAATTGCTTAGAGTATTGGAATCTCATAAATATCGCCCAGTAGGATCTGAAAAAGAATTGGATTCTAA
CTTTAGATTAGTGGTGGCTACTCATTTAAATCTAAAACAACAGGTATTGGATAATAAGTTCCGCAAGGAT
TTGTATTATCGCTTATATCAATACCCCATCACTTTGCCGCGTTTAAAAGATCGCAAGTCAGATATTGAAA
AACTCAGTGCGCATTTTGTTGAACAATATAATGCCAAGCACAAATCCAGCGTGCGTGGTCTGCATTATAA
AGCGATGGATTGCTTACTCGATTATGACTTCCCTGGAAATGTTCGAGAATTAAAACATCTTATTGAATAT
GGTGCTGCTCAGACGCAAAACGGTGAGCAAATTGAACTGGCCTACATTCAATTGAAACTTGACAGTGAAA
TGGCTAGCTCAAGTCAACCTGAGCCAAAAAATAGAGCTTTGGTTGAGCTTTCCACCATTCGAGATCTTAA
AGTGGCGGTAAGGGAATATGAGTCCAATATCATTGCTGCTCGATTGCGTGAATTTGATGGAGATAGAGGA
CGAACTGCTGAGAGTTTGGGCATACCCAAACGAACCTTGGCAGATAAGTGTTTGAAATTGGAGATTTCCA
TAAATGATTAG
 Primer design