SecReT6
Protein ID: 152995237
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1208
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1350913..1352322 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA6VUK8
KEGG IDmmw:Mmwyl1_1208
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.50E-15, Aligned region: 49..108
Protein Sequence: 469 a.a.     [Download]
>gi|152995237|ref|YP_001340072.1| ImpA domain-containing protein [Marinomonas sp. MWYL1]
MDINLIRTSIREPISTDQPVGESAIHDPLYEFVDDQMMKVGSLSHGSVQWKKAEESLIELLSKKTKDLKL
LTYFFQCLHNKNTPDSLTLSIFVLADFMSEYWETCFPFAGKKGNLPRRKFLGQIIQRFGLALDKLDFANF
TTSERESLRTANDFWHGVAKEQELASENVETIIEVINRKLQNSEKKHVETQSKSQPQAEYKTVEVVPSKP
AIEVDYSSAKSTKQTMLKVAEFLSENENSLELSIRIRRYAVWSPITTLPDNVNKQTLISALPQERVKDYW
SLLDSADLALWKRVEATLTVAPYWFDGQFLSYQIAEKLGYTESAQAVLTETQRFLQRFPSLYDFTFKDGE
VFVSDACRNWLEQADETNVEETNLAGDSWAEKKKMAVDLVEKEGIGAALSMINEGISKAVEPRDNYYWRL
ISTELLEENKLNDLAQQQFQQLHTQVQSMSVSEWEPSLLKRVKKHITVK
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1350913-1352322 Marinomonas sp. MWYL1 chromosome, complete genome
ATGGACATTAATCTTATTCGAACATCGATTCGTGAGCCTATATCCACTGATCAGCCTGTTGGCGAAAGCG
CTATTCATGATCCGCTTTATGAGTTTGTGGATGATCAAATGATGAAGGTTGGCTCTTTGTCTCATGGTTC
AGTGCAATGGAAAAAAGCAGAAGAGTCGCTAATTGAACTGCTGAGTAAAAAAACCAAGGATCTAAAACTG
CTGACGTATTTTTTTCAATGCCTACACAATAAAAATACACCAGATAGTTTAACTTTATCCATTTTCGTTT
TAGCCGATTTTATGTCGGAATATTGGGAGACATGCTTTCCATTCGCTGGAAAGAAAGGGAATTTACCGAG
ACGTAAGTTTCTTGGGCAAATTATTCAGCGTTTTGGCCTTGCTCTAGATAAGCTGGACTTTGCCAACTTT
ACTACCTCAGAAAGAGAGAGTTTACGTACTGCCAATGACTTTTGGCATGGTGTTGCGAAAGAACAGGAAC
TTGCTTCTGAGAATGTTGAAACCATCATCGAGGTTATTAACAGAAAGCTCCAAAACTCAGAAAAAAAGCA
TGTAGAAACGCAAAGTAAATCTCAACCTCAGGCTGAATATAAAACTGTAGAGGTCGTGCCTTCTAAACCA
GCGATTGAAGTGGATTACAGCTCTGCAAAAAGCACTAAGCAGACCATGCTGAAAGTCGCCGAATTCCTCT
CGGAAAACGAAAATAGTCTGGAATTATCCATTCGGATTAGGCGCTATGCGGTTTGGTCGCCGATTACCAC
ATTGCCAGATAATGTGAACAAGCAAACTTTGATTAGTGCTTTGCCGCAAGAGCGAGTGAAAGACTATTGG
AGCTTGCTTGATAGTGCAGACCTAGCCTTATGGAAGCGAGTTGAAGCCACGCTGACCGTTGCACCTTATT
GGTTTGATGGGCAGTTTCTAAGCTATCAAATTGCTGAAAAATTAGGGTACACGGAATCTGCTCAAGCCGT
TCTAACGGAAACTCAGCGATTTCTTCAGCGTTTTCCCTCCCTGTATGATTTCACCTTTAAAGATGGTGAA
GTTTTCGTTTCTGATGCTTGTCGGAATTGGCTGGAACAAGCAGATGAAACGAATGTAGAAGAAACTAACC
TAGCTGGTGACAGCTGGGCGGAGAAAAAGAAAATGGCCGTTGATTTAGTGGAAAAAGAAGGCATTGGTGC
CGCTTTATCCATGATCAATGAAGGGATTAGTAAAGCGGTGGAGCCAAGGGATAATTATTATTGGCGCCTT
ATTTCTACGGAATTATTGGAAGAAAATAAACTAAATGATTTAGCCCAGCAGCAGTTTCAGCAACTACATA
CACAAGTTCAGTCAATGTCGGTTTCGGAATGGGAACCCTCTTTGCTCAAGCGAGTAAAGAAGCACATTAC
AGTCAAATAA
 Primer design