SecReT6
Protein ID: 152995238
SecReT6 ID216
T6SS typei1
Gene symbol-
Locus tagMmwyl1_1209
StrainMarinomonas sp. MWYL1
Repliconchromosome [GenBank: NC_009654] [Browse all T6SS(s) in this replicon]
Location [Strand]1352337..1355885 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA6VUK9
KEGG IDmmw:Mmwyl1_1209
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.20E-92, Aligned region: 511..827
ImcF-related_N [PF14331], Evalue: 2.20E-77, Aligned region: 97..129
ImcF-related_N [PF14331], Evalue: 2.20E-77, Aligned region: 203..460
DUF1215 [PF06744], Evalue: 7.60E-37, Aligned region: 921..1041
DUF4131 [PF13567], Evalue: 0.0079, Aligned region: 19..92
Protein Sequence: 1182 a.a.     [Download]
>gi|152995238|ref|YP_001340073.1| ImcF domain-containing protein [Marinomonas sp. MWYL1]
MFKPLVGLLKKLVPSLVAALPFLTLLIVILINLAIWLTGPWLIINEEAPLASISARLLTMVIFSLACLAA
WGLFQWRKLNAYHAELQREEELREDPVKAAEENQEAELNKVMTNMQESLNKRNYLYALPWYLVMGLENAG
KTSLINRSGQDFTFSSILKSSGEGSKNAYSFDWWVGDTSVLIDPDGELLTQGKNVSDPTSDGVMEKRLWE
HFIHWLERTRSRRPLNGIVLALDVSKLATSTIYERKAFATILRSRIRELMETLSTRLPVYVTLTKLDLLY
GFEPFFKNYTKEQREEVLGFTFSLSSVDDHDNWMKEFDAEYEEFISRVNAILPHIVAKNISDEDRNAVYS
FTRQISGLKDILSVFFQDALSSDQFSTSALVRGVYFTSVYQQGVPTNAFDDASSRRYGLTHAINSAQNAK
NSTMYFTKNLFNNIIYPEAGLASDNFRVSKQKKRIMLLSTVSCSIISLILIGSWHRYYLKNIEQADAVLS
KVNLYMEEYPADMDLVSQNEILPPLNTIRDATLEFGFFRDKPRYISDLGLYQGHAIGPQVEMTYLNLLEY
RYLPSLMLELVADLKSADTDENKLSILRVYRMLVDKNGRYDEFVLNYFSRKWQVKYSGNKAIQDKLLQHL
AYALQHTDLYGARLAGDENADKVLRPYDKLIATTQDGLSSLAIDERVYRNLKLSAQTALGADLNIRTLVG
PSFNLVFDEREIGSDKLNVPKVLTKEGFKSYFLPQSESVSDLALIDSWVLGQTETAQFSKADKQALKEKI
RDSYVSDYTNTWRNVLNEIDIKNFSNISEAVDVLDNLTGNGKPLQRLLAALRDNTKLYPEIPEDGEAREE
MLKSASYNLASRLNAPFAELNRIVESNDGQPAYIDELLLSIEQLRTYLAAIQDAPDMGRAALETTKSRAS
LNSVDPIYTLSRVATGLPKPLDSMMSKLADESWYVIKQEAIRYLEVRWHDDIYKVYEQKFAGRYPFDPSS
SRDVSLQDFEAFFAPDGILDRFYNDQLKMFIDENSNINGGHHGKSLIRKDVLKQLGKAKLIQEAFFNRKG
ILDVSFGVEPILLSANKRRGVLNIDGQYLSYSHGPRNNVEVIWPNTLRDNTTSKLTLVPTEANESPRSIS
TEGPWSLYRLLDTAKVVGASDSSVTYQFTVDNGYMEVKVNATTSNPFTQRLFKNFELSKTLY
 
Nucleotide Sequence: 3549 bp     [Download]
>gi|152994043|ref|NC_009654.1|:1352337-1355885 Marinomonas sp. MWYL1 chromosome, complete genome
ATGTTCAAACCTTTAGTTGGCCTATTAAAAAAACTCGTACCCAGCCTTGTGGCGGCGCTGCCGTTTTTAA
CCTTACTAATAGTCATCCTAATCAACCTTGCTATTTGGTTGACAGGGCCGTGGCTAATCATAAACGAAGA
GGCGCCATTGGCGTCTATTAGTGCTCGTTTATTGACTATGGTTATTTTCTCTCTTGCCTGTTTGGCGGCT
TGGGGACTATTTCAGTGGCGTAAGCTCAATGCTTATCACGCAGAACTTCAACGTGAAGAAGAGCTGCGAG
AAGACCCTGTAAAAGCGGCCGAAGAAAACCAAGAGGCCGAATTAAATAAAGTCATGACTAACATGCAAGA
AAGCCTTAATAAGCGTAACTACCTTTATGCTTTGCCTTGGTATCTTGTCATGGGGCTTGAAAATGCCGGT
AAAACCAGCCTAATTAACCGCTCTGGTCAGGATTTTACTTTCTCCTCCATTCTAAAATCTTCCGGAGAGG
GCAGTAAAAACGCCTATTCTTTTGATTGGTGGGTTGGTGATACTTCTGTATTGATTGATCCAGATGGCGA
GTTATTGACGCAAGGCAAGAATGTTTCTGATCCAACTAGCGATGGCGTGATGGAAAAACGCCTATGGGAA
CATTTTATACATTGGCTTGAACGAACTCGTAGTCGCCGCCCGCTGAACGGTATTGTATTAGCGCTTGATG
TATCGAAATTAGCGACTTCAACTATTTATGAAAGAAAAGCATTTGCGACTATTTTAAGGTCTCGAATCCG
TGAGCTTATGGAAACCTTGTCCACTCGCTTGCCTGTGTATGTGACCTTAACCAAGTTAGATTTGCTCTAT
GGTTTTGAACCATTCTTTAAAAATTACACGAAAGAACAGCGTGAAGAGGTACTTGGTTTTACCTTCTCGC
TTTCCTCTGTTGATGACCATGATAACTGGATGAAGGAGTTTGATGCGGAATACGAAGAGTTTATTAGCCG
CGTTAATGCCATATTGCCCCACATAGTCGCTAAGAACATTAGTGATGAAGATCGTAATGCTGTGTACAGC
TTCACAAGACAAATCAGTGGTTTAAAAGACATACTGTCAGTATTTTTCCAAGATGCGTTAAGTAGCGACC
AATTCTCTACTTCAGCATTGGTACGTGGAGTGTACTTTACGTCTGTTTATCAGCAAGGTGTTCCAACTAA
CGCCTTTGATGATGCCTCGTCACGACGTTATGGTCTGACTCATGCCATAAACAGTGCTCAAAATGCCAAA
AACTCGACCATGTACTTCACCAAGAATTTGTTTAATAACATTATTTATCCAGAAGCGGGTTTGGCATCGG
ATAACTTCCGAGTGAGTAAGCAGAAAAAACGCATTATGCTCTTGAGCACAGTGTCTTGTTCCATCATCTC
TTTGATTCTGATCGGATCATGGCACCGTTATTATTTAAAGAATATTGAGCAAGCGGATGCGGTATTGAGC
AAGGTTAACTTGTACATGGAAGAGTATCCTGCGGATATGGACTTGGTGTCTCAGAATGAGATCTTACCGC
CGTTGAATACCATTCGTGATGCGACTTTAGAGTTTGGTTTTTTCCGTGATAAGCCAAGATACATTTCAGA
TTTAGGTTTATATCAAGGGCATGCCATTGGTCCTCAAGTCGAAATGACGTATCTGAATCTGTTGGAGTAC
CGCTATCTACCTTCTTTAATGTTGGAGCTGGTCGCTGACCTTAAAAGCGCCGATACGGATGAAAATAAGC
TTTCAATATTGAGAGTTTATCGAATGCTGGTGGACAAAAACGGTCGTTATGATGAGTTTGTACTGAATTA
TTTTTCACGCAAGTGGCAAGTTAAATATTCCGGAAACAAGGCGATTCAAGACAAGCTTTTACAGCATTTA
GCCTACGCGTTGCAGCATACAGATCTCTATGGGGCTCGCCTTGCTGGAGATGAAAATGCCGATAAAGTAT
TGCGACCTTACGATAAGTTAATCGCCACCACCCAAGATGGTTTAAGCTCTTTGGCGATTGATGAACGTGT
TTACAGAAACCTAAAACTGTCAGCGCAAACTGCACTTGGTGCCGATCTTAATATTCGTACCTTGGTTGGT
CCTTCATTCAATCTAGTTTTCGATGAAAGAGAAATTGGCAGCGATAAACTGAATGTCCCTAAAGTCTTGA
CCAAAGAAGGCTTTAAAAGCTATTTCCTACCGCAATCTGAATCCGTGTCTGATTTGGCTTTGATTGACAG
CTGGGTGTTAGGACAAACGGAAACAGCGCAATTCAGTAAAGCTGATAAGCAGGCATTGAAAGAAAAAATT
AGAGATTCCTATGTCAGTGATTACACGAATACATGGCGAAATGTTTTAAATGAAATTGATATTAAGAACT
TCTCTAATATCAGCGAAGCCGTCGATGTATTGGATAATCTAACCGGCAATGGCAAACCTTTGCAGCGCTT
GCTTGCTGCCTTAAGGGATAACACCAAACTCTATCCTGAAATTCCTGAGGATGGAGAAGCGCGTGAAGAA
ATGCTGAAAAGTGCTAGCTACAACTTGGCTTCTAGATTGAATGCGCCGTTTGCTGAGCTGAACCGTATTG
TGGAATCTAACGATGGTCAGCCAGCTTATATTGATGAACTATTGTTATCTATTGAGCAATTAAGAACTTA
TCTTGCTGCAATTCAAGATGCTCCTGATATGGGACGTGCCGCATTAGAGACGACTAAATCACGAGCTTCA
TTGAATAGTGTTGATCCAATTTACACCCTTTCTAGGGTGGCGACAGGGCTTCCAAAACCTCTGGATTCTA
TGATGTCTAAGCTGGCTGATGAAAGTTGGTATGTCATTAAGCAAGAAGCAATTCGTTACTTAGAAGTGAG
ATGGCATGACGACATCTATAAAGTCTATGAGCAGAAATTTGCCGGACGCTATCCGTTTGATCCTAGCTCA
AGTCGTGATGTGTCGTTGCAAGACTTTGAAGCCTTCTTTGCGCCAGACGGCATTTTAGACCGATTCTATA
ACGATCAGTTAAAAATGTTTATTGATGAAAACTCCAATATCAATGGCGGTCATCATGGTAAATCATTGAT
CCGTAAGGATGTGCTTAAGCAGCTAGGAAAAGCAAAATTAATTCAAGAAGCTTTCTTTAATAGAAAAGGC
ATATTGGATGTTAGCTTCGGCGTGGAGCCGATCCTTTTATCTGCGAATAAGCGAAGAGGCGTGTTGAATA
TCGATGGTCAATATTTATCTTACAGTCATGGACCAAGAAATAATGTAGAAGTTATTTGGCCGAATACGCT
AAGAGATAACACCACATCGAAATTGACCTTAGTGCCAACTGAGGCTAACGAGTCACCGCGTAGTATCTCA
ACAGAAGGTCCTTGGTCGCTTTATCGTTTGCTTGATACAGCGAAAGTGGTGGGCGCTAGTGACTCCAGCG
TGACTTATCAATTTACGGTTGATAATGGCTATATGGAAGTCAAAGTGAATGCAACCACCTCCAATCCGTT
TACTCAGCGCTTATTTAAAAACTTCGAGCTGTCTAAAACCTTGTATTAA
 Primer design